[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57199.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   28->131 1a0kA PDBj 6e-10 20.0 %
:RPS:SCOP  16->131 1skoB  d.110.7.1 * 5e-14 17.7 %
:HMM:SCOP  6->137 1j3wA_ d.110.7.1 * 1.1e-25 40.0 %
:RPS:PFM   25->105 PF03259 * Robl_LC7 6e-04 35.9 %
:HMM:PFM   24->106 PF03259 * Robl_LC7 4.7e-23 46.2 80/91  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57199.1 GT:GENE BAD57199.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2518358..2518792 GB:FROM 2518358 GB:TO 2518792 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57199.1 LENGTH 144 SQ:AASEQ MMGTTNTAVTDSSNRLGWLLEDLSIPGVRFAVLLSDDGLRIAHSSGIARDDAERFAAAASGLRSLGKALGEFCGGPESGVRQNMTEYDDGMIFITAAGEGALLGVSTTTEIDVSLIAHRMNELAGRVGHELGSMPRQRTDSDLS GT:EXON 1|1-144:0| SEG 48->59|arddaerfaaaa| RP:PDB:NREP 1 RP:PDB:REP 28->131|1a0kA|6e-10|20.0|100/130| RP:PFM:NREP 1 RP:PFM:REP 25->105|PF03259|6e-04|35.9|78/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 24->106|PF03259|4.7e-23|46.2|80/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 16->131|1skoB|5e-14|17.7|113/116|d.110.7.1| HM:SCP:REP 6->137|1j3wA_|1.1e-25|40.0|130/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 63 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ----3-------------------------------5-12-323----1-----------21--4637956---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 74.3 SQ:SECSTR ###########################ccEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTTcTTcEEETTEEETEEEEEEEEETTTEEEEEETTEEEEEEEcccEEETTccHHHHHHHHHHHHHHHHTT########## DISOP:02AL 1-15, 135-144| PSIPRED cccccccccccccHHHHHHHHHHccHHHEEEEEEcccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccc //