[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57200.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   43->88 1bg3A PDBj 8e-05 4.3 %
:RPS:PFM   10->114 PF05331 * DUF742 2e-16 54.4 %
:HMM:PFM   6->114 PF05331 * DUF742 5.9e-37 49.5 107/114  
:BLT:SWISS 62->116 PRMA_RHILO 6e-04 34.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57200.1 GT:GENE BAD57200.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2518789..2519139 GB:FROM 2518789 GB:TO 2519139 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57200.1 LENGTH 116 SQ:AASEQ MSRHRRDPDLVRAYVRTGGRSRPTRDLDLVTLVVAASDPPTGASPDARRVMNLCSRRGALSIAEIAAYLDMPPSVVKIVVSDLLDGGNLSTPTPAQMLPEISLLEEVLNGLRALPA GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 62->116|PRMA_RHILO|6e-04|34.5|55/100| RP:PDB:NREP 1 RP:PDB:REP 43->88|1bg3A|8e-05|4.3|46/902| RP:PFM:NREP 1 RP:PFM:REP 10->114|PF05331|2e-16|54.4|103/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 6->114|PF05331|5.9e-37|49.5|107/114|DUF742| OP:NHOMO 58 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----5--------------------1------1---2----221----1---------------4549984---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 47 STR:RPRED 40.5 SQ:SECSTR ##########################################HHHHHHHHHHHHHHHHHHHHHHHTGGGcccHHHHHHHHHHHHHHHHc########################### DISOP:02AL 1-6| PSIPRED cccccccccccccEEEEcccccccccccEEEEEEEcccccccccHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHccEEEEcccccccccHHHHHHHHHHHHHccc //