[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57201.1
DDBJ      :             putative ATP/GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  64/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:183 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   3->65 3cx7A PDBj 6e-06 22.2 %
:RPS:SCOP  5->37 1zd9A1  c.37.1.8 * 6e-04 27.3 %
:HMM:SCOP  1->181 2fu5C1 c.37.1.8 * 6.1e-18 24.4 %
:HMM:PFM   9->174 PF03029 * ATP_bind_1 1.2e-25 32.9 164/238  
:BLT:SWISS 5->135 Y1339_METJA 2e-08 30.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57201.1 GT:GENE BAD57201.1 GT:PRODUCT putative ATP/GTP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2519168..2519719 GB:FROM 2519168 GB:TO 2519719 GB:DIRECTION + GB:PRODUCT putative ATP/GTP-binding protein GB:PROTEIN_ID BAD57201.1 LENGTH 183 SQ:AASEQ MTRSVKLLVAGNFGVGKTTFVSSVSEIKPLRTEETITEASIGVDDMAGLPGKTQTTVAMDFGRITLNPTLALYLFGTPGQQRFVPLWEELARGALGALVLVDTRRIEKSDEVLSVLEERGVPYSVAVNQFDDGRVYPLDEVRDALDLSPETPLTNLDARHRGTCLQSLITLVEYLFHRVESRV GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 5->135|Y1339_METJA|2e-08|30.6|111/154| SEG 86->101|lweelargalgalvlv| RP:PDB:NREP 1 RP:PDB:REP 3->65|3cx7A|6e-06|22.2|63/319| HM:PFM:NREP 1 HM:PFM:REP 9->174|PF03029|1.2e-25|32.9|164/238|ATP_bind_1| RP:SCP:NREP 1 RP:SCP:REP 5->37|1zd9A1|6e-04|27.3|33/164|c.37.1.8| HM:SCP:REP 1->181|2fu5C1|6.1e-18|24.4|160/0|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 149 OP:NHOMOORG 67 OP:PATTERN ----------------11-------------------------------------------------- ----9----------1111-11--111111111111511214352---1-----------53--465BD96--------------111----------------------------------------------1-11122---3----2---1-----------1-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------11111--------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11---------------------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 92.9 SQ:SECSTR ccccEEEEEEccTTccHHHHHHHHHHHHcccccHHHHHTTHHHHHHHHHHHHHHHHHHHHHTTccEEEcccccccccccHHHHHHHHHHHHccccEEEEEccTTccHHHHHHHHHHHTTcccEEEEcccTTc#####ccccHHHHHHHHcccEEcccTTTcccHHHHHHHHHHHH######## PSIPRED cccEEEEEEEEcccccHHHHHHHHHHcccccccccccEEEEEEEccccccccEEEEEEEEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccc //