[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57204.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->50 PF07338 * DUF1471 0.00093 39.1 23/65  
:BLT:SWISS 13->35 Y1289_MYCBO 5e-06 73.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57204.1 GT:GENE BAD57204.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2520815..2520982) GB:FROM 2520815 GB:TO 2520982 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57204.1 LENGTH 55 SQ:AASEQ MRVRLEPAAADRAPLELFGCYHVSQQNTFTGRLTPAMLEAVLAEAADAAGLRTTS GT:EXON 1|1-55:0| BL:SWS:NREP 1 BL:SWS:REP 13->35|Y1289_MYCBO|5e-06|73.9|23/268| SEG 36->49|amleavlaeaadaa| HM:PFM:NREP 1 HM:PFM:REP 28->50|PF07338|0.00093|39.1|23/65|DUF1471| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 53-55| PSIPRED ccccccccccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHccccccc //