[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57205.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.124.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   93->184 2g40A PDBj 2e-10 36.4 %
:HMM:SCOP  48->214 2g40A1 c.124.1.7 * 1.2e-21 29.2 %
:HMM:PFM   125->188 PF02589 * DUF162 2.4e-12 31.7 63/109  
:HMM:PFM   49->108 PF11855 * DUF3375 0.00032 36.8 57/478  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57205.1 GT:GENE BAD57205.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2521767..2522411 GB:FROM 2521767 GB:TO 2522411 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57205.1 LENGTH 214 SQ:AASEQ MRTARTPEGGAVSSDEQLLRRVRDLLVELPDDERVVPVRRGRHAAIDPADRAGLVSAFLARLARDGGRGRRVAEEEVAAALDDALRALGATAVMVPDGLPAALLAPWRNAGHRVVTDSPMLAAEEFDGIDAVVTTCAAAVADSGALVLDGGPGQMRRAARLDVAWHVCLVRAEQIGPSLPEVVDRLDPRRSITMFGGPGQESAGGAGLVVLVVE GT:EXON 1|1-214:0| SEG 15->36|deqllrrvrdllvelpddervv| SEG 59->90|larlardggrgrrvaeeevaaalddalralga| SEG 131->141|avvttcaaava| SEG 196->213|ggpgqesaggaglvvlvv| BL:PDB:NREP 1 BL:PDB:REP 93->184|2g40A|2e-10|36.4|88/164| HM:PFM:NREP 2 HM:PFM:REP 125->188|PF02589|2.4e-12|31.7|63/109|DUF162| HM:PFM:REP 49->108|PF11855|0.00032|36.8|57/478|DUF3375| HM:SCP:REP 48->214|2g40A1|1.2e-21|29.2|161/0|c.124.1.7|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------11-1-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 41.1 SQ:SECSTR ############################################################################################EEccTTccG####GGccTTcEEEcccccccHHHHHHccEEEEcccEEETTTTEEEEcccTTTccGGGGTcccEEEEEEEGGGEEccHHHHHH############################## DISOP:02AL 1-13| PSIPRED ccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHcccccccccccccHHHHccccEEEEEEEEEEEcccEEEEEcccccccEEEEccccEEEEEEEHHHHHccHHHHHHHHcccccEEEEEcccccccccccEEEEEEc //