[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57208.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->123 PF10738 * Lpp-LpqN 5.5e-05 29.9 117/241  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57208.1 GT:GENE BAD57208.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2524045..2524461 GB:FROM 2524045 GB:TO 2524461 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57208.1 LENGTH 138 SQ:AASEQ MTVTAHTRVRAAVAAGLCACAAGLAVATAPAAAGAVTGLKTLPNLTWGIDSDYGTGCTATIQAFVTDPVAPVYFYDNGIPLATVRPTGGVALVTWVPATPGMHRISAGQAPDAVAAVAVDVWTGVGTPVGYGCVVTGA GT:EXON 1|1-138:0| TM:NTM 1 TM:REGION 13->35| SEG 2->38|tvtahtrvraavaaglcacaaglavatapaaagavtg| SEG 112->121|davaavavdv| HM:PFM:NREP 1 HM:PFM:REP 7->123|PF10738|5.5e-05|29.9|117/241|Lpp-LpqN| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cEEEccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccHHEEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEEEccccccEEccccccccHHHHHEEHHHHcccccccccEEEEcc //