[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57213.1
DDBJ      :             putative kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  320/915 : Eukaryota  124/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->167 1ko5A PDBj 3e-18 36.5 %
:RPS:PDB   26->169 3cr8B PDBj 1e-09 18.4 %
:RPS:SCOP  27->167 1knqA  c.37.1.17 * 4e-14 32.6 %
:HMM:SCOP  2->168 1knqA_ c.37.1.17 * 2.1e-27 28.7 %
:HMM:PFM   17->122 PF01202 * SKI 8.2e-14 25.7 101/158  
:BLT:SWISS 26->148 IDNK_ECOLI 2e-19 39.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57213.1 GT:GENE BAD57213.1 GT:PRODUCT putative kinase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2529876..2530391 GB:FROM 2529876 GB:TO 2530391 GB:DIRECTION + GB:PRODUCT putative kinase GB:PROTEIN_ID BAD57213.1 LENGTH 171 SQ:AASEQ MTQNESAPRVVVMGVTGSGKTTVGTRLAAALGVPFAEGDDFHPAANIERMRAGIPLTDAERRPWLDRIAAWLAGATGGGVVSCSALARAYRDTLRAAAPDVLFVHLDVPRPVLDRRVRERRGHFMAPQLLDSQLALLEPLGPDEPGVVLDGTRPPEELVARARELMRTTPR GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 26->148|IDNK_ECOLI|2e-19|39.8|123/187| SEG 10->25|vvvmgvtgsgkttvgt| SEG 106->121|ldvprpvldrrvrerr| BL:PDB:NREP 1 BL:PDB:REP 31->167|1ko5A|3e-18|36.5|137/172| RP:PDB:NREP 1 RP:PDB:REP 26->169|3cr8B|1e-09|18.4|114/493| HM:PFM:NREP 1 HM:PFM:REP 17->122|PF01202|8.2e-14|25.7|101/158|SKI| RP:SCP:NREP 1 RP:SCP:REP 27->167|1knqA|4e-14|32.6|141/171|c.37.1.17| HM:SCP:REP 2->168|1knqA_|2.1e-27|28.7|167/0|c.37.1.17|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 540 OP:NHOMOORG 444 OP:PATTERN -------------------------------------------------------------------- 11--2111111111111----1--11-----111111222----11--121-2321-1----11-1121111---111--------------------------1-1-------------------------------------1-111111--------------11111--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------2111111111111----------1-11-12-1111--111321122212-11-1--1-------1111111112211-------------------------------------1-----1111111111111121111121111111--1111-1111111---------1-1111111--------------------------------1-11-----------------------------112--1--112-1111----------1----------------11211112112221212-1121212122112222221121111112222222222212122211111121-222222222222---------------111111111-----11111111111---2111111111111111111----------1-1-1111111111--11111111-------------------------------------------------------------1- ----111-2---11-11112212111111---111-11111--11111332222211112221111111111111111-111111111-1-11-11111111-111--------1--1--11111111-22---12-1----1------11-11-1112----11------1111-1--3----11--1111------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 84.2 SQ:SECSTR #########################HTcccccEEEEccHHHHHHHTTHHHHTTccccHHHHHHHHHHHHHHHHHTTcEEEEccccccHHHHHHHHHHHHTEEEEEEEccHHHHHHHHHTcTcEEEEEEEcccccccccccccccccEEEcccccHHHHHHHHHHHHHHH## DISOP:02AL 1-6, 8-10, 170-171| PSIPRED ccccccccEEEEEccccccHHHHHHHHHHHcccEEEccHHccHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHHHHHHccc //