[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57214.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:275 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57214.1 GT:GENE BAD57214.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2530434..2531261) GB:FROM 2530434 GB:TO 2531261 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57214.1 LENGTH 275 SQ:AASEQ MRCGGAIARVRRVHTAELVDRGASLVDRLTTTQSPPPWQLVLVTAVLALVLVAAGPLWRITRNAVTIAHEGGHALVALVTGRRLDSITLHSDTSGLTVSRGKPYGPGMILTALAGYPAPPLLGLGFAALLAADRITLMLWTSIALLAAVLIKVRNLYGLCTVLALGALVFAVSWFGTDLVQAAFAYLAAWFLLFAGLRPVVEMQRGRRHRWGNPGGVDSDADQLAALTHLPALLWVLIFAAIALAALLYGGGLLLSEATGLCLPAISSGNCPAPG GT:EXON 1|1-275:0| TM:NTM 5 TM:REGION 40->62| TM:REGION 124->146| TM:REGION 155->177| TM:REGION 181->203| TM:REGION 235->257| SEG 40->54|lvlvtavlalvlvaa| SEG 110->132|ltalagypappllglgfaallaa| SEG 182->195|aafaylaawfllfa| SEG 232->255|allwvlifaaialaallyggglll| OP:NHOMO 23 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1111-211---1111---------111-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 204-220, 271-275| PSIPRED ccccHHHHHHHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHEEEEEEccEEEEEEEEEccccEEEEccccccHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccc //