[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57215.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  251/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:350 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->350 3gfgB PDBj 1e-52 31.0 %
:RPS:PDB   2->345 3e82B PDBj 4e-39 34.9 %
:RPS:SCOP  1->148 1zh8A1  c.2.1.3 * 7e-19 14.3 %
:RPS:SCOP  133->265 1zh8A2  d.81.1.5 * 9e-17 17.7 %
:HMM:SCOP  4->161 1ofgA1 c.2.1.3 * 1.2e-43 42.7 %
:HMM:SCOP  129->271 1zh8A2 d.81.1.5 * 5e-26 32.9 %
:RPS:PFM   6->80 PF01408 * GFO_IDH_MocA 2e-04 40.3 %
:HMM:PFM   5->123 PF01408 * GFO_IDH_MocA 4.4e-28 38.5 117/120  
:HMM:PFM   139->230 PF02894 * GFO_IDH_MocA_C 3e-15 34.8 92/115  
:BLT:SWISS 1->350 YVAA_BACSU 3e-52 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57215.1 GT:GENE BAD57215.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2531282..2532334) GB:FROM 2531282 GB:TO 2532334 GB:DIRECTION - GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD57215.1 LENGTH 350 SQ:AASEQ MSSLDVAVIGYGLAGAVFHAPLIAAHPRMRVAAVVTGSAERAEQARREHPGVRVLPDADALFADPGDVGLVVVATPNRTHAPLALRAVAAGLAVVVDKPFAVSAAEAAEVVAAARRANVVLSVFQNRRWDGDFRTVCRLVETGELGEVRRFESRFERWRPVSKGGWREVGTAADGAGLLYDLGSHLVDQALTLFGPVRSVYCELDNRRPEVRTDDDVFLALTHHSGVRAHLWASAVAPRLGPRFRVLGARAGYVTFGLDPQEDALRAGRRPGGSDWGTTPPEAWGTLGAEPDSAPYPTLPGDYPAFYDGMARAVLDGGPVPVDPADAVAGLRVLEAARRSAEDGLVVAVD GT:EXON 1|1-350:0| BL:SWS:NREP 1 BL:SWS:REP 1->350|YVAA_BACSU|3e-52|31.0|342/358| SEG 81->96|aplalravaaglavvv| SEG 101->123|avsaaeaaevvaaarranvvlsv| BL:PDB:NREP 1 BL:PDB:REP 1->350|3gfgB|1e-52|31.0|342/350| RP:PDB:NREP 1 RP:PDB:REP 2->345|3e82B|4e-39|34.9|321/342| RP:PFM:NREP 1 RP:PFM:REP 6->80|PF01408|2e-04|40.3|72/119|GFO_IDH_MocA| HM:PFM:NREP 2 HM:PFM:REP 5->123|PF01408|4.4e-28|38.5|117/120|GFO_IDH_MocA| HM:PFM:REP 139->230|PF02894|3e-15|34.8|92/115|GFO_IDH_MocA_C| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01408|IPR000683| RP:SCP:NREP 2 RP:SCP:REP 1->148|1zh8A1|7e-19|14.3|147/181|c.2.1.3| RP:SCP:REP 133->265|1zh8A2|9e-17|17.7|130/144|d.81.1.5| HM:SCP:REP 4->161|1ofgA1|1.2e-43|42.7|157/220|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 129->271|1zh8A2|5e-26|32.9|140/0|d.81.1.5|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 409 OP:NHOMOORG 304 OP:PATTERN -------------------------------------------------------------------- 1---1---111-----1-------------------1-111---1-1-111-323-11------1-1111------------------11---------111---111-1----------------------------------1------------------------------------------------1112122221222222--11-1221----131222222-1--------------------1----------11------2111111---2---------------------------------------1-1--11111111-1--------------111------------------1---1---------------------------------------------------1----------------------------1---------------------------------------1-1-----111111111111111111111112------1111-------11---1----1----------1-------------------------------11-1---------------------------1--1------1------1-------------------------2211-212222222222-222222222222212222233311111222122222222221112222222--111111111111---------------1111111----------1----------111-11---1------111--------------11111---111111111111--------------------------------------------------------------- --------------1221-1111212111----111----------1111223222212111------------------------21-11221-1----1-1111-1-----------------------------------1-------------------1------------------------------1211- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 350 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEcccHHHHHTHHHHHHTcTTEEEEEEEcccHHHHHHHHHHcTTcEEEccHHHHHHcTTTccEEEEcccGGGHHHHHHHHHHTTcEEEEcccccccHHHHHHHHHHHHTTccEEEcccGcTTcHHHHHHHHHHHHTTTccEEEEEEEEEccccTTccTTGGGGcTTccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccTTcccccEEEEEEEcccccEEEEEEEcccccccccEEEEEccEEEEEcccccHHHHHHTTccTTcTTTTcccccEEEEEETTccEEEEccccccTHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHHHHHHHHcccEEcc PSIPRED cccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccEEEccHHHHHcccccccEEEEEccHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccccccEEEEHHHHHHHHHHHHccccEEEEEEHHcccccccccEEEEEEEEEccccEEEEEEEEEEcccccEEEEEEcccEEEEEccccccEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccEEEcc //