[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57218.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  193/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.43.4d.153.1
:244 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->224 2gpjA PDBj 4e-27 35.6 %
:RPS:PDB   5->103 1a8pA PDBj 3e-05 10.8 %
:RPS:SCOP  2->94 1ep1B1  b.43.4.2 * 3e-07 14.8 %
:RPS:SCOP  123->236 2i3oA1  d.153.1.6 * 1e-04 20.2 %
:HMM:SCOP  2->102 1jb9A1 b.43.4.2 * 1e-10 27.8 %
:RPS:PFM   1->95 PF08021 * FAD_binding_9 1e-18 55.3 %
:RPS:PFM   102->221 PF04954 * SIP 4e-14 43.2 %
:HMM:PFM   102->221 PF04954 * SIP 8.1e-40 53.4 118/119  
:HMM:PFM   3->95 PF08021 * FAD_binding_9 1.5e-30 52.2 92/117  
:BLT:SWISS 1->239 Y2919_MYCBO 2e-58 56.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57218.1 GT:GENE BAD57218.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2534192..2534926) GB:FROM 2534192 GB:TO 2534926 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57218.1 LENGTH 244 SQ:AASEQ MLRTEQLTPHLIRVHFGGPGFAAFRPSEFSDSYIKLIFPRADGEVLRTYTVRRVDAAAAELAVDFVYHGDEGVAGPWAASVQPGETIDVYGPGGAYSPRQDADWHLLAGDEAALPAIAAALETMDPGASGLAFVEVPGPADELPLTTPAGIELTWLHRGDRPAGELLAETVRAAQWRPGRVQVFIHGEAHAVMQDLRRYIRREREVPAEWASSISGYWRRGRTEEGFRQWKADLAAKESAPAAS GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 1->239|Y2919_MYCBO|2e-58|56.5|239/283| SEG 107->121|lagdeaalpaiaaal| BL:PDB:NREP 1 BL:PDB:REP 1->224|2gpjA|4e-27|35.6|216/240| RP:PDB:NREP 1 RP:PDB:REP 5->103|1a8pA|3e-05|10.8|93/257| RP:PFM:NREP 2 RP:PFM:REP 1->95|PF08021|1e-18|55.3|94/117|FAD_binding_9| RP:PFM:REP 102->221|PF04954|4e-14|43.2|118/118|SIP| HM:PFM:NREP 2 HM:PFM:REP 102->221|PF04954|8.1e-40|53.4|118/119|SIP| HM:PFM:REP 3->95|PF08021|1.5e-30|52.2|92/117|FAD_binding_9| RP:SCP:NREP 2 RP:SCP:REP 2->94|1ep1B1|3e-07|14.8|88/101|b.43.4.2| RP:SCP:REP 123->236|2i3oA1|1e-04|20.2|94/504|d.153.1.6| HM:SCP:REP 2->102|1jb9A1|1e-10|27.8|97/0|b.43.4.2|1/1|Riboflavin synthase domain-like| OP:NHOMO 276 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- ----32-111211113222-21--21222222111117441-121422222-322111--221-5342381-----------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------------2--1-----------1---------1---222----111--2-----111------11111111-11-----------------------------------------11-11111111111111111111-11111111--111-----2-1-1--1----11--------------1---------------------------11-----------------------------11-1-1--2---1111-1-1111----1---------------1111--1---------------------------------11111----------------2---------1--------------------------1-2------------------------1--11122221-1211-111-----------11111111112112211111------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 90.2 SQ:SECSTR EEEEEEEETTEEEEEEEccTTccccTcccTTcEEEEEEEETTEEEEEEEEccEcccTTccEEEEEEEcccccccHHHHTTccTTcEEEEEccccccccGGGccEEEEEEEGGHHHHHHHHHH#ccTTcEEEEEEEEccGGGcccccccTEEEEEEEEccccTTcHHHHHHHTTcccccccEEEEEEEEHHH##HHHHHHHHHHccccGGGEEE#EEEEcTTccH#################### DISOP:02AL 236-244| PSIPRED cEEEEEEcccEEEEEEEcccccccccccccccEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEEccccHHHHHHHHcccccEEEEEcccccccccccccEEEEEEccHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHccccccEEEEEEccccccHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHcccHHHHccccccccccccHHHHHHHHHHHHHHHHccccc //