[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57219.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->85 PF10836 * DUF2574 4.9e-06 37.8 37/93  
:HMM:PFM   41->51 PF06404 * PSK 0.00017 81.8 11/79  
:BLT:SWISS 53->118 EUTH_SALTY 8e-04 33.3 %
:TM
:REPEAT 2|3->50|56->101

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57219.1 GT:GENE BAD57219.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2535013..2535384) GB:FROM 2535013 GB:TO 2535384 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57219.1 LENGTH 123 SQ:AASEQ MSVLVRVGLLELAFGAMFGWVIAGSHAAPRLFERWGVVSPRRLLQAHLDYIIMGVILIAVGLAVPDLAGWIVALVILGTLLNPTLFLPLAFREELTGHLAYRAVSVLSFLATSVGLVAAAFSY GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 53->118|EUTH_SALTY|8e-04|33.3|66/408| TM:NTM 4 TM:REGION 2->24| TM:REGION 43->65| TM:REGION 70->92| TM:REGION 100->122| NREPEAT 1 REPEAT 2|3->50|56->101| HM:PFM:NREP 2 HM:PFM:REP 49->85|PF10836|4.9e-06|37.8|37/93|DUF2574| HM:PFM:REP 41->51|PF06404|0.00017|81.8|11/79|PSK| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------1----------1----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,45-46,48-48,53-53,59-59,95-95,101-102,104-104,109-109| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //