[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57220.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->106 1w8iA_ c.120.1.1 * 2.6e-09 35.1 %
:HMM:PFM   3->104 PF01850 * PIN 1.1e-06 28.1 89/126  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57220.1 GT:GENE BAD57220.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2535406..2535786) GB:FROM 2535406 GB:TO 2535786 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57220.1 LENGTH 126 SQ:AASEQ MRTLLASSVAVVSPLVLDEVDHLLVARFGKDRRVADLVLDDLLTSAEEGAILVPPVDHHDLRVAQRLINQFGGLRLDLADAVNVVLAERYLTNAIVTLDERDFRALTPLTPSFAAFHLPIQDGESE GT:EXON 1|1-126:0| SEG 4->17|llassvavvsplvl| SEG 31->43|drrvadlvlddll| HM:PFM:NREP 1 HM:PFM:REP 3->104|PF01850|1.1e-06|28.1|89/126|PIN| HM:SCP:REP 1->106|1w8iA_|2.6e-09|35.1|97/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 122-126| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEHHHcccccccccccEEEEEEccccccc //