[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57221.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->37 2cpgC PDBj 1e-04 24.3 %
:HMM:PFM   5->34 PF01402 * RHH_1 1e-08 43.3 30/39  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57221.1 GT:GENE BAD57221.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2535855..2536085) GB:FROM 2535855 GB:TO 2536085 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD57221.1 LENGTH 76 SQ:AASEQ MKIKTSVYLDQEQVERLKRAAEAAGRSEADLIREGVDLVLLRTPRAPRTREWPSFDSGDPRFAVDAEEHLRSAYER GT:EXON 1|1-76:0| RP:PDB:NREP 1 RP:PDB:REP 1->37|2cpgC|1e-04|24.3|37/42| HM:PFM:NREP 1 HM:PFM:REP 5->34|PF01402|1e-08|43.3|30/39|RHH_1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 48.7 SQ:SECSTR ccccccccccHHHHHHHHHHHHHHTccHHHHHHHHHH####################################### DISOP:02AL 1-3, 18-26, 72-76| PSIPRED ccccccEEEcHHHHHHHHHHHHHccccHHHHHHccccEEEEEcccccccccccccccccccEEEcHHHHHHHHHcc //