[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57222.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 58->108 TGON2_HUMAN 3e-04 35.3 %
:REPEAT 2|67->76|77->86
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57222.1 GT:GENE BAD57222.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2536494..2536835) GB:FROM 2536494 GB:TO 2536835 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57222.1 LENGTH 113 SQ:AASEQ MAMSGDTDLPLPDYDQLEVGSIEHRIRALDLDAVRRLLDHERGAAHRPRVVAILSARIDQLEAGAQPSGGDPGNAPPVHGEPGGSPVHPAHSPADNTPLRHGVAGQTPARGKP GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 58->108|TGON2_HUMAN|3e-04|35.3|51/100| NREPEAT 1 REPEAT 2|67->76|77->86| SEG 25->39|riraldldavrrlld| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------1---1--------1-1-------1-----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 60-113| PSIPRED ccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc //