[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57223.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:TM
:REPEAT 2|23->59|90->126

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57223.1 GT:GENE BAD57223.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2537142..2537618) GB:FROM 2537142 GB:TO 2537618 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57223.1 LENGTH 158 SQ:AASEQ MPAPGVPPLRLISAFTILVPVSPRLAVPMPRMSIKDPIVLSLRCWFQEPADAGLGGRIAEPAGTQPAKPVMPSSEPRNTSHNPSPATAEPRAGIKAPSRSLSEPIANLLRPWYAPDFTAIEGWAVAHSVHAISCDRGNISSDQLADKACFTFSRIHGM GT:EXON 1|1-158:0| TM:NTM 1 TM:REGION 6->28| NREPEAT 1 REPEAT 2|23->59|90->126| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 65-98| PSIPRED cccccccHHHHHHHHHHEEEcccccccccccccccccEEEEEEEccccccccccccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHEEEEEcccccccHHHHHHHHHHHHHHHHcc //