[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57225.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.43.1
:464 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   79->160 189lA PDBj 7e-04 13.2 %
:RPS:SCOP  78->158 1l5aA1  c.43.1.2 * 9e-04 16.2 %
:HMM:SCOP  65->174 1l5aA1 c.43.1.2 * 0.00028 31.0 %
:RPS:PFM   14->162 PF03007 * UPF0089 6e-10 37.9 %
:HMM:PFM   12->261 PF03007 * UPF0089 9.2e-30 32.4 241/263  
:HMM:PFM   378->453 PF06974 * DUF1298 4.1e-05 25.3 75/153  
:BLT:SWISS 22->406 Y3154_MYCBO 3e-20 28.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57225.1 GT:GENE BAD57225.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2538710..2540104 GB:FROM 2538710 GB:TO 2540104 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57225.1 LENGTH 464 SQ:AASEQ MSDAARVSAQRLHPRDAVFVYDETDTHPSTVVGCYACTATTPLTEAAVLDWVRDRLGLAPLFHRRLRRVPLDLDLPYWVPHPDPDLRAHVSLRTGGTWDDARRVIAELAATPMDLARPPWEIHVLDLISDVPGLPGETTVVVLKFHHGAADGVATRELELKLFGSDPLPPPPTFDRTPWLPSAALRTASALTVGTARFAAGLRRTRTTEPADLPPPLPTRPATRFNRPVHRPLVFDLVTLPLADIRRARAASDTPVTLNDLLLTTVSLALGDYLAERGELPAGSLAAMVPMSVRGIGWTSANQLCQRYVDLHTDVPDPLVRLAAVHRSAAREKQRNVHPDVLRAESRVETAPAWLLRLAGWARARRDYRTVETVPLMNTTVSNVPPVATDLAFLGRPVTRIFGVLPTMDGDCLRHLVTSQGEEVVISFSTDETAMPDPRHYGDLLRAAFATLRDLLVDSGDRAG GT:EXON 1|1-464:0| BL:SWS:NREP 1 BL:SWS:REP 22->406|Y3154_MYCBO|3e-20|28.1|366/463| SEG 64->76|rrlrrvpldldlp| SEG 166->181|dplpppptfdrtpwlp| SEG 210->224|padlppplptrpatr| SEG 353->366|awllrlagwararr| RP:PDB:NREP 1 RP:PDB:REP 79->160|189lA|7e-04|13.2|76/164| RP:PFM:NREP 1 RP:PFM:REP 14->162|PF03007|6e-10|37.9|140/259|UPF0089| HM:PFM:NREP 2 HM:PFM:REP 12->261|PF03007|9.2e-30|32.4|241/263|UPF0089| HM:PFM:REP 378->453|PF06974|4.1e-05|25.3|75/153|DUF1298| RP:SCP:NREP 1 RP:SCP:REP 78->158|1l5aA1|9e-04|16.2|74/174|c.43.1.2| HM:SCP:REP 65->174|1l5aA1|0.00028|31.0|100/0|c.43.1.2|1/1|CoA-dependent acyltransferases| OP:NHOMO 70 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- --------------32222-24--4122222223432343----------------------1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----------------------------------------------1-1---1----------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------2-----------------------1----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 16.4 SQ:SECSTR ##############################################################################HHHHHHHHHHTccccccccTTTHHHHHHHHHHHHHHHHHcTTTHHHHHHccH######HHHHHHHHHHHHHHHHHHHccHHH################################################################################################################################################################################################################################################################################################################ DISOP:02AL 1-7, 165-182, 328-336, 460-464| PSIPRED ccccccccHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccHHHHHHHHHHHHHHccccccEEEEccccccccEEcccccccccEEEEEcccccHHHHHHHHHHHHHcccccccccEEEEEEEccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccEEEEcccccccccEEccEEEEEEEEcccccccccEEEEEEEEccEEEEEEEEcHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccc //