[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57226.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  125/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->73 1b0nA PDBj 2e-05 16.9 %
:RPS:PDB   63->179 3e7jA PDBj 5e-04 12.0 %
:RPS:SCOP  8->82 2ao9A1  a.4.1.17 * 1e-05 11.1 %
:HMM:PFM   69->101 PF00989 * PAS 0.0003 33.3 33/113  
:PROS 82->96|PS00678|WD_REPEATS_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57226.1 GT:GENE BAD57226.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2539992..2540801) GB:FROM 2539992 GB:TO 2540801 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD57226.1 LENGTH 269 SQ:AASEQ MGVVSLSGVSATWYTWLEQGRDIQPSRQVLDALAATLRLTPTEHHYLLSLAGYAPLPAADEPANHRAPEHIQHLLDAVPFPAYAIAPDWQISGWNAAYLELYPNVAAVAPADRNLLWLVFTDLYVRDLLPDWEITSRRFLAEFRAEAGPRLGDLARSPAIRRLLDDNATFRQAWRSHHIEGFASRERVFQHPVRGELRYEHHRLAPADHPDLHLVMYTPVGPDDRCGGRPSAFIPPGHRCRPAGLAGWRTLRAAGHRNAADPASPSRRC GT:EXON 1|1-269:0| PROS 82->96|PS00678|WD_REPEATS_1|PDOC00574| RP:PDB:NREP 2 RP:PDB:REP 6->73|1b0nA|2e-05|16.9|65/103| RP:PDB:REP 63->179|3e7jA|5e-04|12.0|117/743| HM:PFM:NREP 1 HM:PFM:REP 69->101|PF00989|0.0003|33.3|33/113|PAS| RP:SCP:NREP 1 RP:SCP:REP 8->82|2ao9A1|1e-05|11.1|72/117|a.4.1.17| OP:NHOMO 257 OP:NHOMOORG 125 OP:PATTERN -------------------------------------------------------------------- ----H--1223---1------1---9------33332231-225621--21-453--3--1---A-66D1--------------------------------------------------------------------------1------------------------------------------------2-------------------------------------33-------------------------1--------------------------------------------------------------------2------------------------------------------------1--------11311---21-----------------1--1---2--1--111-222--1--1-------------------1-1-11-1-----------------------------------111122332321111122121111113231112--11-------------1-----1-----------------------------------------------------------------------11-------1-----------1-----------------------1111-1-------------------------------22212-------------------2-------------------------------------1----------------------------1111----1--------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 63.9 SQ:SECSTR #####HHTccHHHHHHHHTTccccccHHHHHHHHHHHTccHHH##HHHccTTccccHHHHHHHHHHHHccccHcccccccccHHTTcccccGGGGHHHHTccTTcccccccccccccccccHHHHHHHHHHHTcHHHHHHHHTcccccGHHHHHGGcccEEEETTTTEEEEccccTTcE########################################################################################## DISOP:02AL 55-65, 223-247, 256-269| PSIPRED ccHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccccccccccEEEEEcccHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHcccccccccEEEEEcccEEEEEEEEEEcccccccccEEEEEcccccccHHHHcccccccccccccHHHHHHHHHHcccccccccccccccccc //