[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57235.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->101 PF10824 * DUF2580 1.6e-07 30.6 98/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57235.1 GT:GENE BAD57235.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2552037..2552360 GB:FROM 2552037 GB:TO 2552360 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57235.1 LENGTH 107 SQ:AASEQ MDTLKLDPAAIAAYTAIADTVSEQLADAAAASAGAVDQARLEADLGLLGAGFAARFTAAVAEHTQALTTAGQLVAAYGRVLRDYDSAMRTGDAETAAALDKAGEESA GT:EXON 1|1-107:0| SEG 9->18|aaiaaytaia| SEG 26->62|adaaaasagavdqarleadlgllgagfaarftaavae| HM:PFM:NREP 1 HM:PFM:REP 2->101|PF10824|1.6e-07|30.6|98/100|DUF2580| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 103-107| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccc //