[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57237.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:310 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   131->173 PF03748 * FliL 0.00082 20.9 43/149  
:BLT:SWISS 39->70 ICP4_GAHVG 2e-04 64.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57237.1 GT:GENE BAD57237.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2553771..2554703 GB:FROM 2553771 GB:TO 2554703 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57237.1 LENGTH 310 SQ:AASEQ MLRLPEPPKGRRKRKRPPAAERGRPPRPEPGVIDAHSTGEPIPPLPVPDQSRPSGDWSEWLQPSPSRARPGEPPLPRAPLDEPAPEPEEPAAEEAPRLLPSLVDRTGGNPGPALRRPRPQREDGRSGGDRVLAVLVVVGVLVAVGSILWAVLPGSEPSSAPTSVAASPPAVAPTTVAPPVATPGCEQRNSGDIVSGTGPGGTTDGPSAILAFEHAYYVLRSGAAARAVVTPDAAVPPADQIQRGIDQVPVGTRYCVRIGKATAVPALDGLARWEVRLTQQYPNEQPKTFTQVIATRTQAGRTLIASIAMG GT:EXON 1|1-310:0| BL:SWS:NREP 1 BL:SWS:REP 39->70|ICP4_GAHVG|2e-04|64.3|28/100| TM:NTM 1 TM:REGION 134->155| SEG 5->31|peppkgrrkrkrppaaergrpprpepg| SEG 72->100|epplprapldepapepeepaaeeaprllp| SEG 131->145|vlavlvvvgvlvavg| SEG 157->183|pssaptsvaasppavapttvappvatp| SEG 196->206|gtgpggttdgp| SEG 223->238|aaaravvtpdaavppa| HM:PFM:NREP 1 HM:PFM:REP 131->173|PF03748|0.00082|20.9|43/149|FliL| OP:NHOMO 6 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------4-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-99, 112-131, 161-168, 192-196, 198-200| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHHHHHHEEEEEcHHHHHHHHccccccccHHHHHHHHHHccccccEEEEEcccccccccccccEEEEEEEEEccccccccEEEEEEEEEcccEEEEEEEEcc //