[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57239.1
DDBJ      :             putative sugar kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.72.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   166->286 3cqdB PDBj 4e-09 21.4 %
:RPS:SCOP  152->286 2abqA1  c.72.1.1 * 2e-09 19.8 %
:HMM:SCOP  4->304 1rkdA_ c.72.1.1 * 3.2e-28 33.8 %
:HMM:PFM   172->304 PF00294 * PfkB 3.4e-17 30.5 128/300  
:BLT:SWISS 21->270 HLDE_STRCO 2e-30 45.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57239.1 GT:GENE BAD57239.1 GT:PRODUCT putative sugar kinase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2555689..2556663) GB:FROM 2555689 GB:TO 2556663 GB:DIRECTION - GB:PRODUCT putative sugar kinase GB:PROTEIN_ID BAD57239.1 LENGTH 324 SQ:AASEQ MAATGPLVVVGDILLDVDVEGTADRRSPDAPVPVVDVTGRTYRPGGAGLAARLAADDSAEVVLIAGFAPDEASERLRALLGPRVRVVALPLHGATVRKERVLATGPWARPGARGDQRGRRALITRIDYGDGRIGTDPLPDDALDALAAARGVLVSDYGRGASAHPHLRAVLKNAAAPVVWDPHPRGAAPVPGMTLVTPNRGEALDQLAAPPTTDTDLCALTRRWGVRAVAVTLGSEGALVCGRHECTRIALPAERRGPDGCDTCGAGDRFATAATAALADGHDLEQAVRRAVYAAADFVARGAAGTVSVTESAVPEPVAVTSWA GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 21->270|HLDE_STRCO|2e-30|45.6|226/463| SEG 7->19|lvvvgdilldvdv| SEG 45->55|ggaglaarlaa| SEG 136->149|dplpddaldalaaa| SEG 271->279|ataataala| SEG 287->304|avrravyaaadfvargaa| RP:PDB:NREP 1 RP:PDB:REP 166->286|3cqdB|4e-09|21.4|117/308| HM:PFM:NREP 1 HM:PFM:REP 172->304|PF00294|3.4e-17|30.5|128/300|PfkB| RP:SCP:NREP 1 RP:SCP:REP 152->286|2abqA1|2e-09|19.8|131/306|c.72.1.1| HM:SCP:REP 4->304|1rkdA_|3.2e-28|33.8|281/306|c.72.1.1|1/1|Ribokinase-like| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------1-------------------1----1-------11-111-----11---11-1-------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 260 STR:RPRED 80.2 SQ:SECSTR ##########################EEcTTccGGGccccEEEEEcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHHHHTcccTTEEEccccccEEEEEcccTTcccEEEEEcTTcTTTTccGGGccHHHHcTTEEEEEEEHHHHTTccTTcGGGcTccTTHHHHHHHHHHHTTcEEEEEccHHHHHHHccccEEcccHHHHHHHHTcccccTTHHHHHHHTTccccEEEEcGGGcEEEEccccEEEEccccccccccccccTTHHHHHHHHHHHHHHTTccHHH###################################### DISOP:02AL 1-3| PSIPRED ccccccEEEEEcccccEEEEEcccEEcccccccEEEccEEEEEcccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHcccEEEEEcccccccEEEEEEEEccccccEEEEEccccccccEEEEccccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcccEEEEccccccHHHHccccEEEEcHHHHHHHHccccccHHHHHHHHHHccccEEEEEEcccEEEEEEccccEEEEEccccccccEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcc //