[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57240.1
DDBJ      :             putative sugar isomerase
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  423/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.80.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->202 1x92B PDBj 2e-35 46.6 %
:RPS:PDB   38->202 2df8B PDBj 4e-17 12.8 %
:RPS:SCOP  47->202 1tk9A  c.80.1.3 * 4e-48 42.3 %
:HMM:SCOP  15->205 1x92A_ c.80.1.3 * 1.1e-45 36.1 %
:RPS:PFM   125->183 PF01380 * SIS 7e-07 39.0 %
:HMM:PFM   120->194 PF01380 * SIS 3.5e-10 30.7 75/131  
:BLT:SWISS 56->202 GMHA_RHORT 6e-39 49.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57240.1 GT:GENE BAD57240.1 GT:PRODUCT putative sugar isomerase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2556665..2557282) GB:FROM 2556665 GB:TO 2557282 GB:DIRECTION - GB:PRODUCT putative sugar isomerase GB:PROTEIN_ID BAD57240.1 LENGTH 205 SQ:AASEQ MTSSKVQSTRHLVPGTGAELERHFDALSNALRRNLSPAVAHIWTWGEELARVYQRGGRLFTCGNGGSAAEAQHLSAELTGRFRGERQPLSAIALHCDTSSTTAIVNDYGIDEMFARQLRAHGRPGDVLVVLSTSGSSPNVVAAAKAAHDIGMATWAMTGPPPNPLAALCDDAVAIEADTVATVQEMHLVLVHALCTALEAALEVR GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 56->202|GMHA_RHORT|6e-39|49.7|147/188| BL:PDB:NREP 1 BL:PDB:REP 57->202|1x92B|2e-35|46.6|146/197| RP:PDB:NREP 1 RP:PDB:REP 38->202|2df8B|4e-17|12.8|141/324| RP:PFM:NREP 1 RP:PFM:REP 125->183|PF01380|7e-07|39.0|59/131|SIS| HM:PFM:NREP 1 HM:PFM:REP 120->194|PF01380|3.5e-10|30.7|75/131|SIS| GO:PFM:NREP 2 GO:PFM GO:0005529|"GO:sugar binding"|PF01380|IPR001347| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01380|IPR001347| RP:SCP:NREP 1 RP:SCP:REP 47->202|1tk9A|4e-48|42.3|156/188|c.80.1.3| HM:SCP:REP 15->205|1x92A_|1.1e-45|36.1|191/0|c.80.1.3|1/1|SIS domain| OP:NHOMO 594 OP:NHOMOORG 429 OP:PATTERN -----------------------------------111-----------------------111---- 112------------2111-1---1111111-----1-11-1-------11-111-----11---33-1-------------111111--1--------------111----------------11112111111222222-1111-1-1111-----------1------1-1-11-----------111--------------------------------------------------------------------------------------11-----------------------------------------------1--------1------------------1-------------1--1111------------1231112-12--------------------1-11----------1--1-----1----------------1---1211-----------------------------1---1-1111111111112222111122222-111122111---11-111112-11111212211111111-11111-21--1111221111111111111-----1111111-2221211111111112111-222221211-1121111111111111111111--1111-1--11122222222222222222-2222222222222222222222222322222222222222222222222222-222222222232113111111111111311222212211112222----------1111111111211111111111111111122222222222222----------------11111122----------------------------------------------221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 93.7 SQ:SECSTR #############ccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccccEEEEEEcTHHHHHHHHHHHHHTTTTGGGcTTccEEEEEcccHHTTcEEEEEEHHHHHHHGGGcccccccEEEEEccccccHHHHHHHHTcccccccEEEEEccccGHHHHTccEEEEcccccccccccHHHHHHHHHHHHHHHHHTcc DISOP:02AL 1-11| PSIPRED ccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEEccccHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccc //