[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57241.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  234/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->133 2o2xA PDBj 5e-12 45.6 %
:RPS:PDB   30->133 2cftA PDBj 5e-09 12.9 %
:RPS:SCOP  15->137 2o2xA1  c.108.1.19 * 3e-19 36.6 %
:HMM:SCOP  15->165 1yj5A1 c.108.1.9 * 3.1e-34 37.4 %
:RPS:PFM   18->133 PF08645 * PNK3P 5e-09 33.3 %
:HMM:PFM   33->145 PF00702 * Hydrolase 2.9e-08 28.7 94/192  
:HMM:PFM   137->166 PF06871 * TraH_2 0.00047 43.3 30/206  
:BLT:SWISS 16->133 GMHB_PSEAE 2e-15 37.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57241.1 GT:GENE BAD57241.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2557279..2557857) GB:FROM 2557279 GB:TO 2557857 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57241.1 LENGTH 192 SQ:AASEQ MDTIDDTVGAAAPCAVLFDRDDTLIVDVPYLADPAGVRPVPGAAEQLNRLRAAGIRVGVVSNQSGVAAGLISPAQLAAVNARVEELLGPFDTWQVCTHGRDDGCRCRKPEPGLVIDAAAALGTVPADCVLIGDIGSDVAAAVAAGARAVLVPTAKTRPEEIAYAREVALVAPDLADAVTLALSGTSRKDVLS GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 16->133|GMHB_PSEAE|2e-15|37.3|118/178| SEG 138->151|vaaavaagaravlv| SEG 167->182|valvapdladavtlal| BL:PDB:NREP 1 BL:PDB:REP 15->133|2o2xA|5e-12|45.6|114/204| RP:PDB:NREP 1 RP:PDB:REP 30->133|2cftA|5e-09|12.9|93/292| RP:PFM:NREP 1 RP:PFM:REP 18->133|PF08645|5e-09|33.3|111/142|PNK3P| HM:PFM:NREP 2 HM:PFM:REP 33->145|PF00702|2.9e-08|28.7|94/192|Hydrolase| HM:PFM:REP 137->166|PF06871|0.00047|43.3|30/206|TraH_2| RP:SCP:NREP 1 RP:SCP:REP 15->137|2o2xA1|3e-19|36.6|123/209|c.108.1.19| HM:SCP:REP 15->165|1yj5A1|3.1e-34|37.4|147/0|c.108.1.9|1/1|HAD-like| OP:NHOMO 274 OP:NHOMOORG 238 OP:PATTERN ---------------------------------------------------------------1---- 1-2------------11-------------------1----1-------11-111-----11---11-1-------------1----------------------1-1----------------------------111---111--1-1111-----------1-------------------------1-----1-11111112121------111--------------1------------------------11-----------------------------------------------------------------------------------------------1------------------11-111------11------11111---------------------1--------------11--------------------------111-----------------------------------1111122212212222221222221112113111122111111-1111111121111111---111-22211111-1111111112111111111---------1---------------11--1---1111--1-----1---------1---1-1-11---111--------1-12-1---------------------------------11111--------------------------1-------------11222221111111-1---111-11111111----------1111111111111111111----------------------------------------1-----------------------------------------------------12- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 81.8 SQ:SECSTR #####HTcTTcETTTTccccccccccHHHEEEcccTTccHHHHHHHHHHHTcTTcEEEEcccccEEEcTTcHHHHHHHHHcEEEcHHHHHHHHHHHHTcHHccEEccTTcHHHHHHHHTTccccGGGEEEEEcTTTTHHHHHHTTcEEEEcTTcccTTcccc############################## DISOP:02AL 189-192| PSIPRED ccccccccccccccEEEEEcccEEEEcccccccHHHEEEcccHHHHHHHHHHcccEEEEEEccccccHHcccHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHcccHHHEEEEEccHHHHHHHHHccccEEEEcccccccccHHHcccccEEEccHHHHHHHHHHccccccccc //