[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57253.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  218/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->141 1q6wG PDBj 4e-17 39.6 %
:RPS:PDB   6->146 2bi0A PDBj 2e-22 19.1 %
:RPS:SCOP  6->144 1q6wA  d.38.1.4 * 7e-36 38.4 %
:HMM:SCOP  1->147 2bi0A1 d.38.1.4 * 2.1e-36 38.1 %
:RPS:PFM   20->108 PF01575 * MaoC_dehydratas 7e-15 47.2 %
:HMM:PFM   14->111 PF01575 * MaoC_dehydratas 1.1e-24 37.8 98/123  
:BLT:SWISS 10->113 ECH1_MYCTU 5e-13 42.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57253.1 GT:GENE BAD57253.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2570151..2570618) GB:FROM 2570151 GB:TO 2570618 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57253.1 LENGTH 155 SQ:AASEQ MISKPFEDIRVGDTETTAWRTVAEEYVRDFAELTWDRHPLHLDPEYARWTRFGERIAHGALMIATLLGLVELHPAYLQCFYGLDEVRFLAPTRLGDRVHVVSEVVGIRPRPDGETAVVTCRGSLINQDGTTVFTGLFSLLVAGRAHAIERQEVSR GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 10->113|ECH1_MYCTU|5e-13|42.4|99/151| TM:NTM 1 TM:REGION 53->75| BL:PDB:NREP 1 BL:PDB:REP 6->141|1q6wG|4e-17|39.6|134/147| RP:PDB:NREP 1 RP:PDB:REP 6->146|2bi0A|2e-22|19.1|141/327| RP:PFM:NREP 1 RP:PFM:REP 20->108|PF01575|7e-15|47.2|89/116|MaoC_dehydratas| HM:PFM:NREP 1 HM:PFM:REP 14->111|PF01575|1.1e-24|37.8|98/123|MaoC_dehydratas| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 1 RP:SCP:REP 6->144|1q6wA|7e-36|38.4|138/151|d.38.1.4| HM:SCP:REP 1->147|2bi0A1|2.1e-36|38.1|147/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 321 OP:NHOMOORG 234 OP:PATTERN --------212123---------34111--12------------------------------------ ---1---1112---21111-1---1-111111----2234-3----------21121-----2-121---1-----------1----------------1-1-------1---------------------------1121------------------------------------------11132------111111111111111------111-11----------1---------------------------------------------------------------------------------------------2------------------------------------------1--1----1112111111-2-11---1-1111111111112-11111311-31-1-----1--22221122112----311--------2----112-------------------------------21---22321112131------22------411-332--1121-1---22313-------------------131-21-------------------------1------------------------------------1---1------1-----------1--------------------1---1---11--111---1-1-----1--1111---------------------1------------------------------1111-11-1---------------11111-------11211311122211121------------------------------------------11----------------------------------------11-1--1------ ---------------------------------------------------------------------------------------------------------------1-------------------------------3-----------1------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 94.2 SQ:SECSTR ##cccGGGccTTcEcccccEEccHHHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHHHHHHHHHTTTTTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEEcTTcccEEEEEEEEEEcTTccEEEEEEEEEEEccTTccc####### DISOP:02AL 149-155| PSIPRED cccccHHHcccccEEEEccEEEcHHHHHHHHHHHcccccEEccHHHHHHcccccccccHHHHHHHHHHHHHccccccEEEEEEEEEEEccccccccEEEEEEEEEEEEEcccccEEEEEEEEEEEEccccEEEEEEEEEEEcccccccccccccc //