[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57255.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  116/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->177 2ibdB PDBj 1e-14 31.9 %
:RPS:PDB   4->185 3br6A PDBj 2e-20 13.2 %
:RPS:SCOP  4->73 1z77A1  a.4.1.9 * 3e-13 24.3 %
:RPS:SCOP  73->171 1pb6A2  a.121.1.1 * 2e-08 13.1 %
:HMM:SCOP  3->78 1t33A1 a.4.1.9 * 2.4e-14 41.3 %
:HMM:SCOP  73->187 1vi0A2 a.121.1.1 * 2.7e-14 30.4 %
:RPS:PFM   6->49 PF00440 * TetR_N 2e-06 47.7 %
:RPS:PFM   57->169 PF08359 * TetR_C_4 5e-05 25.7 %
:HMM:PFM   8->50 PF00440 * TetR_N 1.7e-17 51.2 43/47  
:HMM:PFM   57->141 PF08359 * TetR_C_4 2.5e-05 18.8 85/133  
:BLT:SWISS 9->116 BETI_AGRT5 9e-08 31.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57255.1 GT:GENE BAD57255.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2572220..2572888 GB:FROM 2572220 GB:TO 2572888 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57255.1 LENGTH 222 SQ:AASEQ MDLRRVQQAAVTLFATKGFAATGIRELGAEAGINSATLYHYVGSKEALLAMIIRSCLDELMEAGTRALRRSADPVAQLAGLVAAHVGITAVNQLTARVAEYEMRALTDANRGELQRMRDEYEMLFGQVLERGARVGLFDIDDPAMCRLAILEMCTGVAHWYRPGGRLALVDVQRYFVRSACRLVAVDPAELDGVDYLQDTRRLDSEPEARSADVWGTGAAAR GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 9->116|BETI_AGRT5|9e-08|31.4|105/206| BL:PDB:NREP 1 BL:PDB:REP 10->177|2ibdB|1e-14|31.9|166/186| RP:PDB:NREP 1 RP:PDB:REP 4->185|3br6A|2e-20|13.2|182/185| RP:PFM:NREP 2 RP:PFM:REP 6->49|PF00440|2e-06|47.7|44/47|TetR_N| RP:PFM:REP 57->169|PF08359|5e-05|25.7|113/132|TetR_C_4| HM:PFM:NREP 2 HM:PFM:REP 8->50|PF00440|1.7e-17|51.2|43/47|TetR_N| HM:PFM:REP 57->141|PF08359|2.5e-05|18.8|85/133|TetR_C_4| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 4->73|1z77A1|3e-13|24.3|70/75|a.4.1.9| RP:SCP:REP 73->171|1pb6A2|2e-08|13.1|99/126|a.121.1.1| HM:SCP:REP 3->78|1t33A1|2.4e-14|41.3|75/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 73->187|1vi0A2|2.7e-14|30.4|115/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 201 OP:NHOMOORG 117 OP:PATTERN -------------------------------------------------------------------- ----11--------21111-11--11111111111176DC-4-3-----------1-1----6--632332-----------2----------------------------------------------------------------------------------------------------11122---1--------------------------122----------1-----------------------------------------------------------------------------------------------------------------------1------------------------------------11-----1----------------1--1---11----------1--16---1111111-11-------------1---------------------------------11--15341---1----------11111-11-1-1--------2---1-12---------11----------1---2-------1---------1--------2--1-------------------------------3---------------------------------------------------------------------------------------------------------------------------------------21-----------------111111------1111---11111-----------------------------------------------------------------------------------------------1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 86.0 SQ:SECSTR #cHHHHHHHHHHHHHHHcTTTccHHHHHHHTTccHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHTTccHHHHTc############################## DISOP:02AL 220-222| PSIPRED ccHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccHHcccccccccccHHHcccccc //