[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57256.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->85 PF04226 * Transgly_assoc 7.3e-13 47.9 48/48  
:HMM:PFM   6->44 PF11712 * Vma12 0.00075 15.4 39/142  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57256.1 GT:GENE BAD57256.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2573125..2573400 GB:FROM 2573125 GB:TO 2573400 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57256.1 LENGTH 91 SQ:AASEQ MLGLGIIGWIIIGGLAGWIASKIMKTDAQQGILLNIVVGVIGGLLGGFLLKLLGVDVEGGGLWFSFFTCLGGAVILLFLVGLVTGRRGAMR GT:EXON 1|1-91:0| TM:NTM 3 TM:REGION 2->24| TM:REGION 31->53| TM:REGION 62->84| SEG 2->20|lglgiigwiiigglagwia| SEG 31->55|gillnivvgviggllggfllkllgv| HM:PFM:NREP 2 HM:PFM:REP 36->85|PF04226|7.3e-13|47.9|48/48|Transgly_assoc| HM:PFM:REP 6->44|PF11712|0.00075|15.4|39/142|Vma12| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-21----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-91| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccc //