[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57259.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->54 PF11387 * DUF2795 1e-06 43.9 %
:HMM:PFM   14->57 PF11387 * DUF2795 1.4e-21 43.2 44/44  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57259.1 GT:GENE BAD57259.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2576188..2576376 GB:FROM 2576188 GB:TO 2576376 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57259.1 LENGTH 62 SQ:AASEQ MGQQVNPIQVQKFLSGVDYPCDREGIVSAAKSNGADDDIVRALEQIPDRTYDGPNAVSQAVS GT:EXON 1|1-62:0| RP:PFM:NREP 1 RP:PFM:REP 14->54|PF11387|1e-06|43.9|41/44|DUF2795| HM:PFM:NREP 1 HM:PFM:REP 14->57|PF11387|1.4e-21|43.2|44/44|DUF2795| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----1-------11--------------------------------------------------------------------------------------------------1-----------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--------111----11------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHc //