[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57263.1
DDBJ      :             putative LSR2 protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->110 PF11774 * Lsr2 1e-15 52.8 %
:HMM:PFM   1->110 PF11774 * Lsr2 8.4e-44 57.8 109/110  
:BLT:SWISS 1->110 LSR2_MYCTU 1e-17 41.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57263.1 GT:GENE BAD57263.1 GT:PRODUCT putative LSR2 protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2579510..2579854 GB:FROM 2579510 GB:TO 2579854 GB:DIRECTION + GB:PRODUCT putative LSR2 protein GB:PROTEIN_ID BAD57263.1 LENGTH 114 SQ:AASEQ MARKVTVLLVDDVDGKSVADETVSFALDGVHYELDLCTANAEQLRSLFAQWTPFARRVGKAAGGTRAPRSRRATEQDQTLAIRRWAQENGMQVSSRGRVSAAVVEAYHKANPHG GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 1->110|LSR2_MYCTU|1e-17|41.8|110/112| SEG 93->104|vssrgrvsaavv| RP:PFM:NREP 1 RP:PFM:REP 1->110|PF11774|1e-15|52.8|106/110|Lsr2| HM:PFM:NREP 1 HM:PFM:REP 1->110|PF11774|8.4e-44|57.8|109/110|Lsr2| OP:NHOMO 76 OP:NHOMOORG 49 OP:PATTERN -------------------------------------------------------------------- -------------111111-11111111111111113163---11-11112-231111--331-2232224---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 57-81, 111-114| PSIPRED cccEEEEEEEEcccccccccEEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHcccc //