[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57267.1
DDBJ      :             putative flavin-containing monooxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  204/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:459 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->417 2vq7C PDBj 3e-19 33.1 %
:RPS:PDB   8->394 1dxlA PDBj 2e-17 14.3 %
:RPS:PDB   365->441 3dhiA PDBj 5e-04 23.4 %
:RPS:SCOP  4->92 1b37A1  c.3.1.2 * 6e-10 28.1 %
:RPS:SCOP  5->27 1sezA1  c.3.1.2 * 6e-05 56.5 %
:RPS:SCOP  114->381 1mo9A1  c.3.1.5 * 3e-11 10.0 %
:HMM:SCOP  4->198 2gvcA1 c.3.1.5 * 7.8e-46 37.5 %
:HMM:SCOP  144->315 2gvcA2 c.3.1.5 * 3.9e-22 40.8 %
:HMM:SCOP  295->427 2gvcA1 c.3.1.5 * 1.1e-09 24.4 %
:RPS:PFM   4->224 PF00743 * FMO-like 1e-37 47.1 %
:HMM:PFM   5->424 PF00743 * FMO-like 3.4e-75 36.5 414/532  
:BLT:SWISS 5->417 FMO2_RABIT 9e-63 38.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57267.1 GT:GENE BAD57267.1 GT:PRODUCT putative flavin-containing monooxygenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2583266..2584645) GB:FROM 2583266 GB:TO 2584645 GB:DIRECTION - GB:PRODUCT putative flavin-containing monooxygenase GB:PROTEIN_ID BAD57267.1 LENGTH 459 SQ:AASEQ MYLPRTAVIGAGISGLTAGKMLTDYGVPYVCFESSDRIGGNWAFGNPNGHSSAYRSLHIDTSKHQLSFRDFPMSADYPDFPHHTQIKAYLDDYCAAFGLAEHIEFGNAVEHARRLPGGGWELTTGRGETRRFDLLVVANGHHWDPRYPDFPGEFGGTVLHAHHYIDPWTPLDFTGKRILVVGLGNSAADIAVELSAKALGNTLTLSTRSGAWIVPKYIAGRPADKYYRTSPYLPLSWQRKIAQWGQPLTAGRPESYGLPTPNHKFFEAHPTQSVELPLRLGSGDVVAKPDIARLDGHTVHFVDGTSGEFDIVVYATGYNITFPFFDPEFISAPDNRIDLYKRMFAPGVEDLVFAGFAQATPTLFPFVEAQARLIGAYAVGRYRLPSPDRMRRVIAEDQQRYTGHMLDRPRHTQQVDYFLYEHDLRVRELPAGADRARRQGPPPWARVAEDDAVAAGGAR GT:EXON 1|1-459:0| BL:SWS:NREP 1 BL:SWS:REP 5->417|FMO2_RABIT|9e-63|38.6|407/535| SEG 445->458|arvaeddavaagga| BL:PDB:NREP 1 BL:PDB:REP 5->417|2vq7C|3e-19|33.1|335/445| RP:PDB:NREP 2 RP:PDB:REP 8->394|1dxlA|2e-17|14.3|335/467| RP:PDB:REP 365->441|3dhiA|5e-04|23.4|77/498| RP:PFM:NREP 1 RP:PFM:REP 4->224|PF00743|1e-37|47.1|206/247|FMO-like| HM:PFM:NREP 1 HM:PFM:REP 5->424|PF00743|3.4e-75|36.5|414/532|FMO-like| GO:PFM:NREP 4 GO:PFM GO:0004499|"GO:flavin-containing monooxygenase activity"|PF00743|IPR000960| GO:PFM GO:0050660|"GO:FAD binding"|PF00743|IPR000960| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF00743|IPR000960| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00743|IPR000960| RP:SCP:NREP 3 RP:SCP:REP 4->92|1b37A1|6e-10|28.1|89/347|c.3.1.2| RP:SCP:REP 5->27|1sezA1|6e-05|56.5|23/353|c.3.1.2| RP:SCP:REP 114->381|1mo9A1|3e-11|10.0|240/261|c.3.1.5| HM:SCP:REP 4->198|2gvcA1|7.8e-46|37.5|192/0|c.3.1.5|1/2|FAD/NAD(P)-binding domain| HM:SCP:REP 144->315|2gvcA2|3.9e-22|40.8|103/0|c.3.1.5|2/2|FAD/NAD(P)-binding domain| HM:SCP:REP 295->427|2gvcA1|1.1e-09|24.4|127/0|c.3.1.5|2/2|FAD/NAD(P)-binding domain| OP:NHOMO 1544 OP:NHOMOORG 379 OP:PATTERN -------------------------------------------------------------------- --1-21-1222---C8A55-5C--97555553CGGGB9F9-1---11-----212--1--121-1322532-------------------------1-----------1-------------------------------2---1-1111----------------1--12-----------------------111111-1-111111-1----11111------------------------------------------------------------------------------------------------------------------------------------------------------------1334------1511-----1--------------111-3-12137-2---1-11111111-21-1-----1-3111111111---1-1------------------------------1273--211--2122222222233212222-26242212--21-14---------1---------------21--------------------------------11------------------------------1--1----1-------1-------1-------------------1-----------1-----------------------------------------------------------------------------1111-5111---------------3313311-----1111-2124-1--1-1-------------------------11--1-------------22--22------------------------------------------------- ----212-211-113C54767B8H9H7222211333244434435542679BHA6694455521-1211-1-11---1--1-1--1---774523533413-2413-283V88964D66776A5EA7C5GY6-B897678A569574464955E6527ABHM1C5122368676525227222228LEK4S6-132226 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 441 STR:RPRED 96.1 SQ:SECSTR cccccEEEEcccHHHHHHHHHHHHHTccEEEEEccccccccHHTcHHcHHHHHHHHHHHHHHHHHHHTHHHHTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTcEEEETTEEEEcccccccEEEEccEEEEcccEEcTEcccTTcccccTTcEccEEcHHHHTTccccccEEEEccccHHHHHHHHHHHHTTcEEEEEEEcccccccTTccHHHHHHHHEcHHTcEEEEEcccccccTTccHHHHHHHHHHHHHccccEEccEEEEEEETccEEEccccEcccccEEEEEEEccccccEEEEEcEEEccccEEEccTTcccTTTTccccccccccTTcccccTTEEEccTTccccccHHHHHHHHHHHHHHHTTccccccTTcccEEEHHTTTTHHHHHHHcTTccccccTHHHTTTTTcGGGGHHHHGGGcccH################## DISOP:02AL 1-2, 458-459| PSIPRED ccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccccEEEccccccccccccEEEcccHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccEEEccEEEEEEEccccEEEEEEcccEEEEEEEEEEEcccccccccccccccccccEEEHHHcccccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEEcccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccHHHHccccccHHHHccccEEEEcccEEEEEccEEEEccccEEEEEEEEEEcccccccccccHHcccccccccccEEccEEcccccEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccHHHcccccccccccccccccccccc //