[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57268.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->79 2uxhB PDBj 2e-08 38.2 %
:RPS:PDB   24->204 3bruA PDBj 2e-16 17.7 %
:RPS:SCOP  24->83 1z77A1  a.4.1.9 * 7e-15 30.0 %
:HMM:SCOP  10->98 1t33A1 a.4.1.9 * 5.5e-17 34.1 %
:HMM:SCOP  92->199 2fq4A2 a.121.1.1 * 1.4e-06 23.1 %
:RPS:PFM   26->71 PF00440 * TetR_N 5e-08 52.2 %
:HMM:PFM   26->71 PF00440 * TetR_N 6.5e-19 58.7 46/47  
:BLT:SWISS 14->209 Y1255_MYCTU 9e-11 29.3 %
:PROS 38->69|PS01081|HTH_TETR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57268.1 GT:GENE BAD57268.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2584773..2585420 GB:FROM 2584773 GB:TO 2585420 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57268.1 LENGTH 215 SQ:AASEQ MPLPWRLEAKARRVSEAPTVSVVDRLLDAAEKLLASKGIRATTVSEVAEAAGVSRAWLYRHFPDKPALIGAAIVRLNETFWQDAGAELERIGTFAEQIAAGVRIGRGAYDDPGALLLRLRTDEPEEFAACAGAGVSGLVPDLAAFWRPFVEAAAARGEIHPGHDLAEVSEWLARVLISLGTVPGETIDPDDPAAVLRWVRTYFLPALRADPAAAQ GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 14->209|Y1255_MYCTU|9e-11|29.3|184/202| PROS 38->69|PS01081|HTH_TETR_1|PDOC00830| BL:PDB:NREP 1 BL:PDB:REP 25->79|2uxhB|2e-08|38.2|55/205| RP:PDB:NREP 1 RP:PDB:REP 24->204|3bruA|2e-16|17.7|181/188| RP:PFM:NREP 1 RP:PFM:REP 26->71|PF00440|5e-08|52.2|46/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 26->71|PF00440|6.5e-19|58.7|46/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 1 RP:SCP:REP 24->83|1z77A1|7e-15|30.0|60/75|a.4.1.9| HM:SCP:REP 10->98|1t33A1|5.5e-17|34.1|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 92->199|2fq4A2|1.4e-06|23.1|108/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 47 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------221----7--2111111234541121--------------------------2-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 96.7 SQ:SECSTR #######HcTccccccccHHHHHHHHHHHHHHHHHHccTTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTcTTccHHHHHHHHHHHHHHTTTTccccHHHHHHHTGGccTHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccTTccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHGGGccHHcccHHHHHH DISOP:02AL 1-25, 212-215| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccc //