[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57269.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->168 3cnwA PDBj 3e-08 10.9 %
:RPS:SCOP  1->167 1xfsA  d.129.3.5 * 1e-12 9.9 %
:HMM:SCOP  1->167 1xfsA_ d.129.3.5 * 2.7e-20 28.1 %
:HMM:PFM   6->164 PF10604 * Polyketide_cyc2 1.3e-27 27.4 135/139  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57269.1 GT:GENE BAD57269.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2585434..2585946) GB:FROM 2585434 GB:TO 2585946 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57269.1 LENGTH 170 SQ:AASEQ MPRSREVTDSVVVAVDPQTAYARISDVTQMGRWSPENTGAALRDPGAPVRVGTRFVGSNVRRGFRWHTECVVTAAEPGRLFAFAVRKFGVRKPVLPVAIASWEYRFEPVEGGSRITETWYDDRAAWPDALTAVFDRLATGTPGFAVYQRGNIRRTLERLKTELEAEAHAG GT:EXON 1|1-170:0| RP:PDB:NREP 1 RP:PDB:REP 7->168|3cnwA|3e-08|10.9|137/139| HM:PFM:NREP 1 HM:PFM:REP 6->164|PF10604|1.3e-27|27.4|135/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 1->167|1xfsA|1e-12|9.9|152/154|d.129.3.5| HM:SCP:REP 1->167|1xfsA_|2.7e-20|28.1|153/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 55 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----1---111-1-32222-21--2-22222114441121---1---1--------------1---1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 95.3 SQ:SECSTR #TTccEEEEEEEEcccHHHHHHHHccTTcGGGTcTTccEEEEEGGGTEEEEccTTccEEEcTTccEEEEEEEEEETTTTEEEEEEEcccEccccEEEEEEEEEEEEcccTTcEEEEEEEEEEEccccHHHHHHHHHHHHHHH#####HHHHHHHHHHHHHHHHHcccc## DISOP:02AL 1-5, 167-170| PSIPRED cccccEEEEEEEEcccHHHHHHHHccccccccccccEEEEEEEccccccccccEEEEEEEcccccccEEEEEEEEEccEEEEEEEEEcccccccccccccEEEEEEEEEcccEEEEEEccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccc //