[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57275.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57275.1 GT:GENE BAD57275.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2593380..2593718 GB:FROM 2593380 GB:TO 2593718 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57275.1 LENGTH 112 SQ:AASEQ MRPRRLIALSLFALLVPLGAACTAEGPGSTADCNVGGCTITFTRGVDAQVSVLGVDAQLVAVDGNLVTLKIAGQQVTVPMGETRPAEGLDVAVQEVTADQVVVKVNTGLTGG GT:EXON 1|1-112:0| TM:NTM 1 TM:REGION 6->22| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------1---------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 111-112| PSIPRED cccHHHHHHHHHHHHHccccEEEccccccccccccccEEEEEEcccccEEEEEEccEEEEEEcccEEEEEEcccEEEEEccccccccccEEEEEEEcccEEEEEEEcccccc //