[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57276.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->137 PF07690 * MFS_1 1e-07 25.6 133/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57276.1 GT:GENE BAD57276.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2593693..2594202) GB:FROM 2593693 GB:TO 2594202 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57276.1 LENGTH 169 SQ:AASEQ MYATLDAARMTGMLAGPVIGGVAVGSVGFAATMALDAMSSIVLVVLMAALGLRRFPPEHPATRRPGWWRQVVEAPALLAANRVVRAAMGALAAAIAFAAMGSVNNAATMLGTLLGAPAVAAVGAGGALVLAGAGTAAATAAAAPALLVRGREQPKDGVVGGVSLRSGRC GT:EXON 1|1-169:0| TM:NTM 3 TM:REGION 22->44| TM:REGION 76->98| TM:REGION 118->140| SEG 15->31|agpviggvavgsvgfaa| SEG 74->99|apallaanrvvraamgalaaaiafaa| SEG 110->148|lgtllgapavaavgaggalvlagagtaaataaaapallv| SEG 157->162|gvvggv| HM:PFM:NREP 1 HM:PFM:REP 2->137|PF07690|1e-07|25.6|133/353|MFS_1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHccccEEEEEcccHHHHHHHHHHHHHHccccccccccEEccccccccc //