[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57281.1
DDBJ      :             putative ABC transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  576/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->308 1xvlA PDBj 4e-87 57.4 %
:RPS:PDB   41->305 3cx3B PDBj 5e-55 21.4 %
:RPS:SCOP  39->310 1xvlA1  c.92.2.2 * 1e-76 58.5 %
:HMM:SCOP  40->310 1toaA_ c.92.2.2 * 7.2e-85 40.4 %
:RPS:PFM   20->308 PF01297 * SBP_bac_9 3e-47 38.9 %
:HMM:PFM   21->308 PF01297 * SBP_bac_9 6.5e-75 35.2 284/303  
:BLT:SWISS 44->304 Y362_HAEIN 2e-78 54.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57281.1 GT:GENE BAD57281.1 GT:PRODUCT putative ABC transporter substrate-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2599348..2600286 GB:FROM 2599348 GB:TO 2600286 GB:DIRECTION + GB:PRODUCT putative ABC transporter substrate-binding protein GB:PROTEIN_ID BAD57281.1 LENGTH 312 SQ:AASEQ MKLVASRAFSVPWRSVTAALAACLMVSVVAACGGARGDDDRPTVLTTFTVLADIAGTVAGEHLRVESITKAGAEIHGYEPTPGDIRKAATADLILDNGLNLEAWFEQFVAEVDVPHAVVSEGVEPIDIAGDAYRGKPNPHAWMSPLNVRIYVDNMVRAFAELDPDHAADFRANGERYKAELDAVHAELTGALSALPESQRALVTCEGAFSYLARDAGLTEKYIWPVNAEQQATPQQITSAIDFVRERAVPAVFCESTVSDAPMRRVVEATGAAFGGVLYVDSLSEPDGPVPTYLALIRHDARTIADALTGRA GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 44->304|Y362_HAEIN|2e-78|54.8|261/293| TM:NTM 1 TM:REGION 13->34| BL:PDB:NREP 1 BL:PDB:REP 39->308|1xvlA|4e-87|57.4|270/279| RP:PDB:NREP 1 RP:PDB:REP 41->305|3cx3B|5e-55|21.4|252/255| RP:PFM:NREP 1 RP:PFM:REP 20->308|PF01297|3e-47|38.9|283/291|SBP_bac_9| HM:PFM:NREP 1 HM:PFM:REP 21->308|PF01297|6.5e-75|35.2|284/303|SBP_bac_9| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF01297|IPR006127| GO:PFM GO:0046872|"GO:metal ion binding"|PF01297|IPR006127| RP:SCP:NREP 1 RP:SCP:REP 39->310|1xvlA1|1e-76|58.5|272/279|c.92.2.2| HM:SCP:REP 40->310|1toaA_|7.2e-85|40.4|270/277|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 863 OP:NHOMOORG 591 OP:PATTERN ------------------------1111-11---1-----------1111111--------------3 ----124-1112121--11-1111111111112111222211-1122-11--31111111221121112121111-1121--11--1-11-1-1--1---------1---12112122122222111-111111-12222211141142222211222113212122432212111112111131-11---1212222212222121212311221212-1112-33333323111111111111111111114121221122233111121112-212333244422222232222332322222222222232311133331111211111111111-111111--1212-11133211111111111-11--1----22222111111111112211111111112-11111211111122211112211112---2121122111------------1-23-----------------------------------11111----------------------11---------1-----1-111--1----111111111--112---211-11-12111-2121--111------11---1----------------11---11-11-----------------------------11111------4112-321112113211-1111311111122111111232221112122222222222222222222222-211111111111--1-------------1-1-1-1-111111111------------11111222-1111-222---------12--2-----111-------------------2--------------22-1-------------------------11--1-1-11-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 86.5 SQ:SECSTR ######################################ccccEEEEccHHHHHHHHHHGGTTcGcEEEccccccTTTccccHHHHHHHHHccEEEEccTTTcGGGGTcccTTTTccccEEETcccTTcccccccccccccGGGcHHHHHHHHHHHHHHTTTccTTcTTEEHHHHHHHHHHHHHHHHHHHHHTTTccGGccEEEEcccccHHHHHHTTcEEEEcccccTTccccHHHHHHHHHHHHHHcccEEEEccccccccTTTHHHHcccEEEEccccccccccccccccHHHHHHHHHHHHTTTc#### DISOP:02AL 1-7, 35-38, 227-231, 233-234, 311-312| PSIPRED cccHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcHHHHHHHHHHcccEEEEEEEEccccccccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHcccccEEEEcccccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccEEEEEcccHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccc //