[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57282.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:245 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   21->239 2nq2D PDBj 3e-28 34.3 %
:RPS:PDB   2->48 2axnA PDBj 4e-09 15.2 %
:RPS:PDB   21->226 2dwpA PDBj 1e-38 8.1 %
:RPS:SCOP  7->229 1b0uA  c.37.1.12 * 2e-40 29.1 %
:HMM:SCOP  9->214 1ii8.1 c.37.1.12 * 5.9e-57 42.1 %
:RPS:PFM   46->168 PF00005 * ABC_tran 8e-16 40.8 %
:HMM:PFM   46->170 PF00005 * ABC_tran 3.8e-23 36.3 113/118  
:HMM:PFM   34->53 PF00931 * NB-ARC 0.00013 55.0 20/285  
:HMM:PFM   218->228 PF12399 * BCA_ABC_TP_C 0.00079 72.7 11/23  
:BLT:SWISS 4->238 YFEB_YERPE 3e-62 52.6 %
:PROS 142->156|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57282.1 GT:GENE BAD57282.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2600283..2601020 GB:FROM 2600283 GB:TO 2601020 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD57282.1 LENGTH 245 SQ:AASEQ MMGELAVDVADVTVRYGEVLALDGVSLTLAPGRICGLVGMNGSGKSTLFKTIVGLVKPTSGTVTLYGDTPRAARRAGLLGYVPQSEDVDWSFPLTVRDVVLTGRHGRMGFPRRPRRADREAVDRALARVELTELADRQIGRLSGGQRKRAFVARALAQEATLLLLDEPFAGVDKRSEAAITTLLRELAGEGAAIVVSTHDLHALPELADEAVLLMRSVLARGTPEEVLRPENLAAAFGLDVLGRS GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 4->238|YFEB_YERPE|3e-62|52.6|234/296| PROS 142->156|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 21->239|2nq2D|3e-28|34.3|207/248| RP:PDB:NREP 2 RP:PDB:REP 2->48|2axnA|4e-09|15.2|46/451| RP:PDB:REP 21->226|2dwpA|1e-38|8.1|186/431| RP:PFM:NREP 1 RP:PFM:REP 46->168|PF00005|8e-16|40.8|120/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 46->170|PF00005|3.8e-23|36.3|113/118|ABC_tran| HM:PFM:REP 34->53|PF00931|0.00013|55.0|20/285|NB-ARC| HM:PFM:REP 218->228|PF12399|0.00079|72.7|11/23|BCA_ABC_TP_C| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 7->229|1b0uA|2e-40|29.1|223/258|c.37.1.12| HM:SCP:REP 9->214|1ii8.1|5.9e-57|42.1|202/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 46982 OP:NHOMOORG 1171 OP:PATTERN TTMDNLHGSRRPOOSMjFOPNQPUuRUhiYfVE7CBDAEEEB9VZPZhLP*xe9OWOTXNJGIDV199 RToM*lkgssubcYaVUQP-PpCCc*QQQQQRuvwx****Z*b*x**k*ojT**zVYmFG***p*w****iZVVV*bcaN*jlB4A77SSNK5MFKD--BFMFIIYHSSK67888878998888HOPFOTJGPPTOlrr**KIK*cmejvccjbgTUNHLFJIdeXl***UEKEFEDDMEGDDkcfTNYZ9chq********y********zz*w***epu**gsknmljk**VccbabZVaZcccaZVSRUWreca**YNWVfuuOP**cUQSecbabihjnokqpqojljjfhjkhgjWXWWVWXXYXXWVxhgYYZkjlle*q********vc*egyzzYddY*gche*coTM**mcXWZcSbgVgaORQfGeVWWOLLLMLeZ***bVw****************-pw*nf*v***UC**************IMP**********UUUUUUUUyejPTle*66556444645676996655656655555DEDJFI***********x************q********AL**p*nvim******ZjmNTGMgWIIIHIIIMNNanlZz*ReYqoYnpgdpFfZcRSXcSVZaZct*a*BEEJ9AAAAC9485555655HM7CGONqrqMvVTHRJkQVYaWMUbXUUVWYXVXYZ6-CPURQ11-222*t**V*tw**zx*x*vw-*wvw*xyvyx**ystvtsr*****efelkgjjjkjkjihkhjk*pknpqpuP3************34FFACABBGHIJRG*l*aaaYVSENQNMTNQZMOQPOGOJOSqZwxuvr***u**wuh***BBB8CCCBBIfjiuoppppu*vqrSQRPOPPKMMEEEE66QNIIBCFF55455555*BPA7866-67649A4BBA56B864667TdbKFbtejbBfO 2122kdH-gL9FTfWKEHCHLQGOLSOLKCDCFGHDBA7979BDCBFAHNSObQGJN7JEBCG79874-9745BC49177A777EH74-IQCEGIH88AAE9DPLM4WtSjXZVpfnMJGCLXOvvByC**r4xWtJKHDiFN*ZDPJJEeCE*GbURyNq*OoKXB*bb*hZeOGLLF*EFFLP*vv*E**LL****b ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccEEEEEEEEEEEEccEEEEEcccEEEEccEEEEEEccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHccccHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEcccEEEEcccHHHHccHHHHHHccccEEEcc //