[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57283.1
DDBJ      :             putative ABC transporter membrane protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  340/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.22.1
:294 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->267 1l7vA_ f.22.1.1 * 1.8e-32 25.3 %
:RPS:PFM   44->267 PF00950 * ABC-3 6e-28 39.3 %
:HMM:PFM   14->268 PF00950 * ABC-3 2.3e-85 43.5 255/258  
:BLT:SWISS 7->275 MNTB_SYNY3 2e-46 42.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57283.1 GT:GENE BAD57283.1 GT:PRODUCT putative ABC transporter membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2601046..2601930 GB:FROM 2601046 GB:TO 2601930 GB:DIRECTION + GB:PRODUCT putative ABC transporter membrane protein GB:PROTEIN_ID BAD57283.1 LENGTH 294 SQ:AASEQ MMNPIEFFLEPLRYEFMVRALTTTVAAALVCAVLSCWLVLIGWSLMGDAVSHAVLPGVVLAYIAGLPFAVGAVVFGFAAVGLIGLVRETSRVKEDAAIGIVFTTFFAAGLVLVSVTPSQTDLNHIVFGNLLGVGRGELVQVVVLAAITLVALVLLRRDFTLFAFDPTHAHAIGLNPRVLGSCLLGLLALTAVVALQAVGVVLVVAMLIIPGATAYLLTDRFQRMLLIAPAVSVAAAVTGLYLSYHLDTASGAMIVVVQGAVFVLVYLFAPRHGILGRRLAARALARRDQVTASR GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 7->275|MNTB_SYNY3|2e-46|42.8|269/306| TM:NTM 7 TM:REGION 21->43| TM:REGION 57->79| TM:REGION 102->124| TM:REGION 134->155| TM:REGION 187->209| TM:REGION 221->243| TM:REGION 252->274| SEG 18->40|vraltttvaaalvcavlscwlvl| SEG 68->81|favgavvfgfaavg| SEG 138->155|lvqvvvlaaitlvalvll| SEG 178->205|vlgscllgllaltavvalqavgvvlvva| SEG 277->287|rrlaaralarr| RP:PFM:NREP 1 RP:PFM:REP 44->267|PF00950|6e-28|39.3|224/257|ABC-3| HM:PFM:NREP 1 HM:PFM:REP 14->268|PF00950|2.3e-85|43.5|255/258|ABC-3| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00950|IPR001626| GO:PFM GO:0006810|"GO:transport"|PF00950|IPR001626| GO:PFM GO:0016020|"GO:membrane"|PF00950|IPR001626| GO:PFM GO:0042626|"GO:ATPase activity, coupled to transmembrane movement of substances"|PF00950|IPR001626| HM:SCP:REP 6->267|1l7vA_|1.8e-32|25.3|257/324|f.22.1.1|1/1|ABC transporter involved in vitamin B12 uptake, BtuC| OP:NHOMO 493 OP:NHOMOORG 346 OP:PATTERN ----------------------------------1-----------1--111---------------1 -----11-111112-------1----------1---2122-----11-1---11111-1111-11-1-1-1-------1---1-----------------------1-----------------11111-11-1--222-21113112222211122111111211211-1111111111111111--------11111--111---1-111111-1-1---21-11111111111111111111111111112---11-----11--111---1-11111111111111111111111111111111111111--------1-1----------1-1-----------1-----122---111----------------23323-----------2211111111113------------22221-1223-33-2---2-22222111------------1-22-------------------------------------------------------------------------------1-----------11--111-1--------1-----1------1-1---1--------1----2--1111-------------------------------------------------2-11-------5--2-22---3-234-------4-3-2--42------333332222222222222222222222222222-222222222222--2---------------222-2-222222222--------------------------111---------1----------------------------------------------1-11-1----------------------1-----------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 280-294| PSIPRED cccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccc //