[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57285.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->82 PF02674 * Colicin_V 5.1e-05 10.5 57/146  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57285.1 GT:GENE BAD57285.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2602777..2603130) GB:FROM 2602777 GB:TO 2603130 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57285.1 LENGTH 117 SQ:AASEQ MVDDVEKRWSDPEGFRKAVRFGLGVVALAALVAVIIGIWAASRDACETGPMLCDTASRVAMVVGPAVVLAAGWIGAFVITYLRWRQGRVWPIWQGTGWFLFFLLLAYLTIGGSVFAR GT:EXON 1|1-117:0| TM:NTM 3 TM:REGION 22->44| TM:REGION 59->81| TM:REGION 95->117| SEG 22->41|glgvvalaalvaviigiwaa| HM:PFM:NREP 1 HM:PFM:REP 26->82|PF02674|5.1e-05|10.5|57/146|Colicin_V| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 5-6| PSIPRED ccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHccHHHcc //