[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57286.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:48 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57286.1 GT:GENE BAD57286.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2603207..2603353) GB:FROM 2603207 GB:TO 2603353 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57286.1 LENGTH 48 SQ:AASEQ MALVILLLLLLFAVTALVVVAAYGTVVATYWFEMRHNHTEPPDLPAMR GT:EXON 1|1-48:0| TM:NTM 1 TM:REGION 6->28| SEG 2->29|alvillllllfavtalvvvaaygtvvat| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 42-45, 47-48| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //