[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57287.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->64 PF00567 * TUDOR 0.00075 24.3 37/122  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57287.1 GT:GENE BAD57287.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2603574..2603843 GB:FROM 2603574 GB:TO 2603843 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57287.1 LENGTH 89 SQ:AASEQ MFRPCRTTPPGRSVAGMRIDDANLTDHAKLAEFYLDKAMQILRPLLEDDLASLPSDEAWVRARTLQGQAQVHATLALREQLSRLPGGAA GT:EXON 1|1-89:0| HM:PFM:NREP 1 HM:PFM:REP 28->64|PF00567|0.00075|24.3|37/122|TUDOR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 87-89| PSIPRED cccccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccc //