[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57289.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  891/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:248 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   10->239 1g291 PDBj 5e-29 36.5 %
:RPS:PDB   16->215 3dmdC PDBj 1e-31 10.1 %
:RPS:SCOP  12->217 1sgwA  c.37.1.12 * 2e-32 16.7 %
:HMM:SCOP  14->216 1ii8.1 c.37.1.12 * 5.5e-60 41.5 %
:RPS:PFM   51->165 PF00005 * ABC_tran 2e-08 35.4 %
:HMM:PFM   51->166 PF00005 * ABC_tran 1.3e-19 36.4 110/118  
:HMM:PFM   24->70 PF03193 * DUF258 9.1e-07 37.0 46/161  
:BLT:SWISS 12->237 Y4187_BRUSU 1e-40 44.4 %
:PROS 139->153|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57289.1 GT:GENE BAD57289.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2606541..2607287) GB:FROM 2606541 GB:TO 2607287 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD57289.1 LENGTH 248 SQ:AASEQ MTTAAIREPAGLTLDGVRLGYRERTVLERLDLTVAPGEILVVVGKSGCGKSSLLRALAGLRPPEAGAVRADGELVTGPSADRALVFQDDALLPWRTARRNIELALRLRGVPRPERRELALRRLDEVGLTGYADYLPRDLSGGMRQRVQLARALAAAPRALLMDEPFGALDTQTRAGMQRLLVDTWRAHPTTVVFVTHDLDEALRLGDRIAVLGRGATGAGVLRALVEVPDPRTPGDRPAVRAEILEHL GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 12->237|Y4187_BRUSU|1e-40|44.4|223/260| PROS 139->153|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 111->123|prperrelalrrl| SEG 144->161|rqrvqlaralaaaprall| BL:PDB:NREP 1 BL:PDB:REP 10->239|1g291|5e-29|36.5|222/372| RP:PDB:NREP 1 RP:PDB:REP 16->215|3dmdC|1e-31|10.1|188/318| RP:PFM:NREP 1 RP:PFM:REP 51->165|PF00005|2e-08|35.4|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 51->166|PF00005|1.3e-19|36.4|110/118|ABC_tran| HM:PFM:REP 24->70|PF03193|9.1e-07|37.0|46/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 12->217|1sgwA|2e-32|16.7|198/200|c.37.1.12| HM:SCP:REP 14->216|1ii8.1|5.5e-60|41.5|200/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 21904 OP:NHOMOORG 1088 OP:PATTERN CC629966ABAA97C7KBABBBACQ9BLLFJD737656ABCB7FJ8KEAFXLL5CDBC9887748122 DKID*LEJLLOCIAJJICC-CP66HxCCCCCCWVWXaq*yFdKoYiXLJPMFaWXIJM11UTRMoZp*y*KIHGGSKJFGRLM12734EEAB18675--579577A7BG9133323333244447CD5BC7498FAKJKPP555RKJHLRGFJJOGHA8A8C7IMJKURNB6C65746B4575EFFBBCD2DESaaaZaahfSdfbaaieTOOOTeceILMYPNSJMONKMspDIIIHIGHHHIIIGGEEDD9UHJDTTFFDEHRSGGTUGCCCNHIHHLLKNLKNKQRLJJKIKKMKKJKKJJJKKKJLKLJSEDIHGFFFJAXNXYNONRRROHMIJWRRDFGBQEKJCdIHD8kmHJEGHDAHCCBA4ADH5MLHHE66868PL***CDQkZUkTcfcgfbgZce*-df*Zbxbm**F4*************r69Dlp*ztx*unoEDEEEEEESIJDGKIb332222222211----2-------12222A78A96b**lmnwyyysgebdYtt**jiiiSftq*hXob2AZYRXMaQTnYzj**IOODEBCNFEECBCBCGEDKSFEIkCOKTRFNVOMWCIJHFKIJJFIHIHXeHR598966677563424333334945788XQS9OFF8C9VCEFFE8EFECDDBEGCDDF3-48KGC------gc*nMeWTWWWUYUXRT-XTSTUVVUSTXXTQSSRRTx*trtIGGRRSSSSSRSSQRSRSSiPPMRRQQE1Vdedgedceegf129966566AAAAG7bUhHHGIHG8CECBGBBKDDDCD6E6BDUHfdbcfsrtZglblPttu5554555559IONTMNNNNSWRTRKIIGHGGCED7888228CAA655633333333C6645423-11422424342234211117G888HGGJE3KA ----554-FA112661-1--11-1-11----------1-1--1---22221221112--1--1--------------------------12-----111-1-1----32666A5F894231394OM3C1Fs92A5D2431B44B628322922e3C74C27J4953289A626956152e232136--I-2521K7BC5 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccccccccccEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccccccEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHccHHHHccHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHcEEEEEcccccccccEEEEEEccccHHHHccHHHHHHHHHHc //