[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57295.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57295.1 GT:GENE BAD57295.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2612623..2613102 GB:FROM 2612623 GB:TO 2613102 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57295.1 LENGTH 159 SQ:AASEQ MGLPQPFPTRGDPKSHTFRAAVAPVPDALDLPTAATVGINGLAASQLAELLGDGPGRLLITGAAGTGGAYLGVRPGMAPAAERDITVDVVETRPDTARLAELLDAAARGVLPTRVHAVVPLSEAAAAHRAVAKGGVRGKYVLAPWRVAGGPEESRRFAD GT:EXON 1|1-159:0| SEG 61->69|tgaagtgga| SEG 97->108|arlaelldaaar| SEG 124->138|aaaahravakggvrg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 152-159| PSIPRED ccccccccccccccEEcHHHHHHHHHHHcccccccccccccccccHHHHHHcccccEEEEEEEEccccEEEEEcccccccccccEEEEEEEEEccHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHccccc //