[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57296.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  305/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->112 3f6vA PDBj 1e-07 38.6 %
:RPS:PDB   41->113 1bibA PDBj 3e-14 15.5 %
:RPS:SCOP  25->113 1r1uA  a.4.5.5 * 7e-15 25.6 %
:HMM:SCOP  12->113 1u2wA1 a.4.5.5 * 3.4e-24 42.0 %
:RPS:PFM   41->89 PF01022 * HTH_5 7e-08 56.5 %
:HMM:PFM   41->90 PF01022 * HTH_5 1e-20 53.2 47/47  
:BLT:SWISS 23->113 BIGR_AGRT5 7e-13 39.8 %
:PROS 60->78|PS00846|HTH_ARSR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57296.1 GT:GENE BAD57296.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2613127..2613504 GB:FROM 2613127 GB:TO 2613504 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57296.1 LENGTH 125 SQ:AASEQ MSNPSLPVAPVDACPPAPLVREPLSEQAAAELAVVFKALSDPVRLRLLSSIASRADQEACVCDLSAGIELTQPTISHHLKVLREAGLLTSERRASWVYYRVVPGAFARLSQLLPVPARRGDEVPA GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 23->113|BIGR_AGRT5|7e-13|39.8|88/117| PROS 60->78|PS00846|HTH_ARSR_1|PDOC00661| SEG 7->20|pvapvdacppaplv| BL:PDB:NREP 1 BL:PDB:REP 40->112|3f6vA|1e-07|38.6|70/96| RP:PDB:NREP 1 RP:PDB:REP 41->113|1bibA|3e-14|15.5|71/294| RP:PFM:NREP 1 RP:PFM:REP 41->89|PF01022|7e-08|56.5|46/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 41->90|PF01022|1e-20|53.2|47/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 25->113|1r1uA|7e-15|25.6|86/94|a.4.5.5| HM:SCP:REP 12->113|1u2wA1|3.4e-24|42.0|100/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 433 OP:NHOMOORG 322 OP:PATTERN ---------------------------1-1----111111111--21-1--11--------------- 11-151111211--4--11-14--121-111132423223-11212112---211-1---321-1222521-----1-----211-1------------------------------------------11---1111111---11--1-11-11111-1-11-2-2221-11111-11-1--12--1---1-111111121111211132---11-1121-1112--1--1-----------------111--------1--1-1------------1--------------------------------------------132-32213222121--33----1-1-111-1-63-122-23131-21--2--------------1-------------------1-------------111-----------------1-------------------1-1------------------------------------------------------------------------------------------1----------------2--211---1----22111-121-----112---------------------1-11-2---111-111-11111--131111112311----11----------1-1-111-1---11-11111---111-11111122211-1-1--------1-------1111-111--211111111111---1-----------2-1---------------21112----11111-1111-121111--1-------------1-----11-22-----------------1------------------------------------------1-1------1--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 77.6 SQ:SECSTR ####################EETTcccccccccccccccHcHHHHHHHHHHTHHTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHHTcc######## DISOP:02AL 1-6, 18-28, 121-125| PSIPRED cccccccccccccccccHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccEEEEEEcHHHHHHHHHHHHHHHHccccccc //