[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57298.1
DDBJ      :             putative arsenate reductase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  223/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->127 2cd7A PDBj 3e-16 37.2 %
:RPS:PDB   5->130 2cd7A PDBj 3e-28 33.6 %
:RPS:SCOP  5->130 1jf8A  c.44.1.1 * 1e-28 32.8 %
:HMM:SCOP  4->131 1jf8A_ c.44.1.1 * 1.5e-37 43.3 %
:RPS:PFM   7->130 PF01451 * LMWPc 2e-08 35.5 %
:HMM:PFM   7->131 PF01451 * LMWPc 2.2e-33 37.6 125/140  
:BLT:SWISS 4->126 ARSC1_STAEQ 2e-17 40.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57298.1 GT:GENE BAD57298.1 GT:PRODUCT putative arsenate reductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2614616..2615029 GB:FROM 2614616 GB:TO 2615029 GB:DIRECTION + GB:PRODUCT putative arsenate reductase GB:PROTEIN_ID BAD57298.1 LENGTH 137 SQ:AASEQ MSNRKPRVLFVCVHNAGRSQMAAAFLAHLAGDAVEVDSAGSDPADHVNPVAVEAMREVGLDLAGRRPQRLTYAAVDAADVVITMGCGDACPVLPGTTYRDWKLDDPAGKGIDAVRPIRDEIRARIEELVAELVPGRA GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 4->126|ARSC1_STAEQ|2e-17|40.5|121/132| SEG 22->33|aaaflahlagda| BL:PDB:NREP 1 BL:PDB:REP 5->127|2cd7A|3e-16|37.2|121/131| RP:PDB:NREP 1 RP:PDB:REP 5->130|2cd7A|3e-28|33.6|125/131| RP:PFM:NREP 1 RP:PFM:REP 7->130|PF01451|2e-08|35.5|124/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 7->131|PF01451|2.2e-33|37.6|125/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 5->130|1jf8A|1e-28|32.8|125/130|c.44.1.1| HM:SCP:REP 4->131|1jf8A_|1.5e-37|43.3|127/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 330 OP:NHOMOORG 253 OP:PATTERN -----------------------111112131--1--112111111-11------1--1-1------1 -12-3--433211142-11-13--1111111-3131541412211212311-512-2----21-1-11211-----1-----111111--11-1--------------1----------------21121-12212---11111-11111111----------11-1111-------------1411-11-21-111111211112-111111-1111-2121--------111-1-1-1111---1111222--121121--1-1--11-1-1-------------------------------------------------1121111112--1111-22-1111-11--2---31----11--1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------1-----1----------------131-1-1-1-11--1-1111-1111111111------1-1--------------------------1-------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1---------------------------1--------1- --------------------21-----------1-----------------------------------------------------------------------------------------------------------------------------------------------1------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 97.1 SQ:SECSTR cccccEEEEEEETTcccHHHHHHHHHHHHcTTTEEEEEEEccccccccHHHHHHHHHTTcccTTcccccccHHHHHHccEEEEccHHHTcccccTTccEEccccccTTccHHHHHHHHHHHHHHHHHHHTHHc#### DISOP:02AL 1-3, 136-137| PSIPRED ccccccEEEEEEcccccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHccccccccccccccHHHHHcccEEEEEcccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccc //