[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57299.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  92/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->150 3b59A PDBj 4e-14 17.3 %
:RPS:SCOP  6->133 1f1rA1  d.32.1.3 * 7e-13 20.2 %
:HMM:SCOP  1->118 1q0oA2 d.32.1.3 * 8.3e-17 31.6 %
:HMM:PFM   6->88 PF00903 * Glyoxalase 2.3e-11 28.9 83/128  
:HMM:PFM   108->132 PF06975 * DUF1299 0.00032 48.0 25/47  
:BLT:SWISS 1->147 CADI_MYCTU 2e-59 71.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57299.1 GT:GENE BAD57299.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2615154..2615660) GB:FROM 2615154 GB:TO 2615660 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57299.1 LENGTH 168 SQ:AASEQ MSRVQLALNVDDLEQAVGFYSTLFGAEPAKRKPGYANFAIDEPPLKLVLIENPGRGGSVNHLGVEVDSSEKVHAEIARLSQAGLFTEEQMATTCCFATQDKVWVTGPDAERWEVYTVLSDTEHFGAAPESTERDDRQAVRACCGSGASAEGDGGTEPTVSCCTPSAVG GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 1->147|CADI_MYCTU|2e-59|71.4|147/152| RP:PDB:NREP 1 RP:PDB:REP 1->150|3b59A|4e-14|17.3|150/294| HM:PFM:NREP 2 HM:PFM:REP 6->88|PF00903|2.3e-11|28.9|83/128|Glyoxalase| HM:PFM:REP 108->132|PF06975|0.00032|48.0|25/47|DUF1299| RP:SCP:NREP 1 RP:SCP:REP 6->133|1f1rA1|7e-13|20.2|124/145|d.32.1.3| HM:SCP:REP 1->118|1q0oA2|8.3e-17|31.6|114/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 102 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- --------------11-11-12--1111111121211-11-111---1------------11---111111---------------------------------------------------------------------------1-------------------1-1----------------------1--11111111-1111111----1111----1--------1---------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------1-----------------1---------------------------------------------------------1-1-----1-------111-221-1111-1---1111--33-11-111----------11--------------------------------------------1-----------------------------------------------------------------1------------------------------------------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 89.3 SQ:SECSTR cccEEEEEEEccHHHHHHHHHHTTccEEEEEcccEEEEEcTTccccccEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHHTcccccccEEcccTTccEEEEEEcTTccEEEEEEcccccccccccTTcccccEEEEEEEEETTHHHHH################## DISOP:02AL 127-137| PSIPRED ccEEEEEEEEccHHHHHHHHHHHHccEEEEEEcccEEEEEccccEEEEEEccccccccEEEEEEEEccHHHHHHHHHHHHHcccEEEcccccccccccccEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccc //