[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57300.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->114 3f6vA PDBj 2e-06 35.1 %
:RPS:PDB   41->118 1bibA PDBj 2e-08 17.1 %
:RPS:SCOP  25->110 1r1uA  a.4.5.5 * 3e-09 24.1 %
:HMM:SCOP  12->121 1u2wA1 a.4.5.5 * 6.3e-23 38.0 %
:HMM:PFM   41->90 PF01022 * HTH_5 3.2e-14 51.1 47/47  
:BLT:SWISS 25->99 CZRA_BACSU 1e-05 34.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57300.1 GT:GENE BAD57300.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2615757..2616116 GB:FROM 2615757 GB:TO 2616116 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57300.1 LENGTH 119 SQ:AASEQ MPKALPVIDMTAPVCCPPVAAGPVDDEAALHVALRLKALADPVRVKLVSLLLAGADTGRNGGELAAAVGLAESTVSHHLGQLRKAGLVTSERQGMTVVHRVHRDALAALCVVLDPNCCR GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 25->99|CZRA_BACSU|1e-05|34.7|72/107| SEG 12->24|apvccppvaagpv| SEG 61->72|ggelaaavglae| BL:PDB:NREP 1 BL:PDB:REP 35->114|3f6vA|2e-06|35.1|77/96| RP:PDB:NREP 1 RP:PDB:REP 41->118|1bibA|2e-08|17.1|76/294| HM:PFM:NREP 1 HM:PFM:REP 41->90|PF01022|3.2e-14|51.1|47/47|HTH_5| RP:SCP:NREP 1 RP:SCP:REP 25->110|1r1uA|3e-09|24.1|83/94|a.4.5.5| HM:SCP:REP 12->121|1u2wA1|6.3e-23|38.0|108/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 30 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ----11--------21-11-12--1111111111312-11-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 78.2 SQ:SECSTR ##########################GGHHHHHHHHHccccHHHHHHHHHHTTccEEcccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTccccc DISOP:02AL 1-3| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccEEEEEEcHHHHHHHHHHHHHHccc //