[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57304.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:386 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   241->285 PF06863 * DUF1254 9.5e-05 22.7 44/118  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57304.1 GT:GENE BAD57304.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2619903..2621063 GB:FROM 2619903 GB:TO 2621063 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57304.1 LENGTH 386 SQ:AASEQ MLTQPFADAMAAAEQIITEAPHIRTEQDLVEGYDYLAGSIRACMQLAWAYDRDFPFFARSTAQYTKMGLDNPDTLYFHTFLRPDAEYVVTGRRGTTRDLSFQVLNGNYSPVDVPDSETAFDDRELDIAPDGSYELRLGPGPGRRGYVHLAEDSAMLVVREVFGDWSEQPGSLRIQRVDTIGVAPPAPSRDLLAKRYEIAGKMLVSRLRTFLTFPEWFYLNLPVNTMTEPRPTPGGLATQFSSVGHYDLTDDQAMIITVPKSDAPYQGFQLGSMWYISLDYINHQTSLNADQARVDPDGMIRLVVAERDPGLVNWIERTGHARGYLQFRWQRLSRELKPEDGPTVEIVPMDELPARLPYYEDARVTPEEWKARIAARQVAVAERMLG GT:EXON 1|1-386:0| SEG 135->145|lrlgpgpgrrg| HM:PFM:NREP 1 HM:PFM:REP 241->285|PF06863|9.5e-05|22.7|44/118|DUF1254| OP:NHOMO 70 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- --------------24411-15--3111111343331311---1----------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------26----------1-------11--------1--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccEEcccccccccEEEEEEccccEEEEEEEEccEEEEEEEEEccEEcccccEEEEEEEcHHHEEEccccEEEEEEcccccccccccccccccEEEEEEEEccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccccccEEEEEEEEEEccccEEEEEEccccccEEEEEEccEEEcccccccccEEEcccEEEEcccccEEEEEEccccccccccccccccccEEEEEEEEEccccccccccEEEEEEccccccHHcccccccccHHHHHHHHHHHHHHHHHHHcc //