[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57308.1
DDBJ      :             putative hydrolase
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  648/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:217 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->210 1te2A PDBj 2e-22 41.7 %
:RPS:PDB   2->213 2ah5A PDBj 9e-30 14.7 %
:RPS:SCOP  5->184 2hdoA1  c.108.1.6 * 1e-35 25.7 %
:HMM:SCOP  1->213 1te2A_ c.108.1.6 * 6.8e-55 33.5 %
:RPS:PFM   86->175 PF00702 * Hydrolase 3e-05 30.7 %
:HMM:PFM   3->178 PF00702 * Hydrolase 4.7e-26 28.0 175/192  
:BLT:SWISS 2->210 YNIC_ECO57 3e-28 41.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57308.1 GT:GENE BAD57308.1 GT:PRODUCT putative hydrolase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2623806..2624459 GB:FROM 2623806 GB:TO 2624459 GB:DIRECTION + GB:PRODUCT putative hydrolase GB:PROTEIN_ID BAD57308.1 LENGTH 217 SQ:AASEQ MQITAVVFDMDGVLIDSEPVWERVRRAYIDDHGGTWQPDTQRRLMGMSTGEWSAYLSRELGVDAPPDRVAAEVIALMSQHYDRAVPLLPGAVEAVRRMSENFPLGLASSSPRALIDTVLGRTGLIEHFTVTLSTEEVARGKPAPDVYLAVADKLGVAPQACAAVEDSSNGLRSAHAAGMRVIAVPRPEYPLDPDARALASALVTDPTALTPALVAGG GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 2->210|YNIC_ECO57|3e-28|41.5|205/222| BL:PDB:NREP 1 BL:PDB:REP 2->210|1te2A|2e-22|41.7|199/211| RP:PDB:NREP 1 RP:PDB:REP 2->213|2ah5A|9e-30|14.7|204/206| RP:PFM:NREP 1 RP:PFM:REP 86->175|PF00702|3e-05|30.7|88/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 3->178|PF00702|4.7e-26|28.0|175/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 5->184|2hdoA1|1e-35|25.7|175/207|c.108.1.6| HM:SCP:REP 1->213|1te2A_|6.8e-55|33.5|212/218|c.108.1.6|1/1|HAD-like| OP:NHOMO 1657 OP:NHOMOORG 777 OP:PATTERN --1-1-------------1-----1--1-1-------------------11-21-------------- 132-111211111-1--11-11---111111-11112111131331222331112311--22122335653222221111111-----111111-----12411131312--------------1321133-221221123111123-13--12222-1-2211-115433-1-1---1-1--4121111112111111111-1-111-1111121111--1-22222221-2-1111111111111-1111131-12311-1144--1122-22-2222221222-11-----------1111111111111-11-11111211-54222221222222331111312-1131-1--111-2---2221--22-22111111113144511-3343322222222224-43244341241-444433225322--11122145441111111111113311221---------------------------------11-22133554532444433443333344453153--22311-2-111132-1312312-----1----1-121--1--21-1-----221122112-1--13-11--------11-------------1114554-31-2211111312122221111222--11111------64325426666656666-6665676665665666666445331234633443344344434433466642-433333323333-----------112-132222212-111112211-11111---3233331122121211432-----------124222223253333323223331111--1-11-----------------------------------------21--1-111122 -----------2111-211--2-111-11-1111211111111-----1-------1-----1-1--1--1--1-1-111-------1-2232132---1121121-24-411-1--11---1-11-21251--1311--11-1--1---1--2-112113-11113511-11312652O1225366A8-661322115 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 100.0 SQ:SECSTR cTccEEEEcccTTTEEcHHHHHHHHHHHHHHHTcccccHHHHHHTcccHHHHHHTTccGGGHHHHHHHHHHHHHHHHHHTGGGccEEcTTHHHHHHHHHTTccEEEEEEEEHHHHHHHHHHTTcGGGccEEEcGEEccccccHHHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEEEEccccccHHHHHTTcccEEEccTTHHHHHTcccc PSIPRED ccccEEEEcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccHHHccEEEEHHHcccccccHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHcccEEEEEcccccccHHHHHccccEEEccHHHHHHHHHHcc //