Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57312.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57312.1 GT:GENE BAD57312.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2626626..2627045 GB:FROM 2626626 GB:TO 2627045 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57312.1 LENGTH 139 SQ:AASEQ MRPESRAPDPGEDRPHLELARAEDDWIRAEYLPEALYHLRYRRAGGDRYELYTADHRWVRDILVAWLARDDRWHESPAWSRIDPAIAELETVRGELSELLDGFGLLDALGEFEDGLDDVLRRADELLGDDGAPADPPPG GT:EXON 1|1-139:0| SEG 98->113|elldgfglldalgefe| SEG 128->138|gddgapadppp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 131-139| PSIPRED ccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccc //