[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57315.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   127->314 2eabB PDBj 4e-04 11.7 %
:HMM:SCOP  1->141 1nvmB1 c.2.1.3 * 4.5e-10 29.8 %
:HMM:PFM   6->104 PF01113 * DapB_N 1.8e-08 31.2 93/124  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57315.1 GT:GENE BAD57315.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2628867..2629946 GB:FROM 2628867 GB:TO 2629946 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57315.1 LENGTH 359 SQ:AASEQ MTMSVRVVQWGTGNVGRHALAGIIAAPGLDLVGVHVSGPDKAGKDAAALAGLDTPTGVTATADVAEILALRPDCVVYCAMTDNRLLEAVEDLRTLLAAGVNVVACAPVFFQYPYDVLPDDLLQPVLRAAADGGASLWVNGIDPGFANDLLPLALAGTCLRIDQLRCLEIVDYASYDNRAVMVDIMGFGKPMDETPMLLQPGVLSLAWGSVVRQLAAGIGVRLDAVTETYERVPAPESFDIATGHIAEGTAAALRFEVRGMVGDRAVTVLEHVTRLRPDLCPDWPQPPHPQGCYRVELTGDPSYVLDLVTSSPRGDHNFATLLATAMRIVNAVPAVVAAPPGLLTALDLPLITRPAVPPS GT:EXON 1|1-359:0| SEG 40->53|dkagkdaaalagld| SEG 111->126|qypydvlpddllqpvl| SEG 331->340|avpavvaapp| RP:PDB:NREP 1 RP:PDB:REP 127->314|2eabB|4e-04|11.7|188/881| HM:PFM:NREP 1 HM:PFM:REP 6->104|PF01113|1.8e-08|31.2|93/124|DapB_N| HM:SCP:REP 1->141|1nvmB1|4.5e-10|29.8|131/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 152 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- ----1---------3AB22-2F--86222223CBCB4222-1-5------------------11-----1---------------------------------------------------------------------11----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1------1--111--------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 52.4 SQ:SECSTR ##############################################################################################################################cccTTccccccTTcccTTccTTccccTTccTTccccccGGGTTTTTcccccTTcHHHHHHHHHHHHHHHEETTEEccccHHHHHHHHHHHHHTTcHHHHHHHHHHHHcTTcccccccccTHHHHHHHHEEcccEEEcTTccEEETcEEEcTTccTTcccEEEETTTEEEEEEEETTEEEEEEEEEccc############################################# DISOP:02AL 1-2, 358-359| PSIPRED cccccEEEEEcccHHHHHHHHHHHcccccEEEEEEEccHHHHcccHHHHHcccccccEEEEccHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEEEEEccccccHHHHHHHHcccccHHcccHHHHccccccHHHHHHHHHHHHcccEEEEEEEEEEEEEEcEEEEcccEEEcccEEEEEEEEEEEEEccEEEEEEEEEEccccccccccccccccccEEEEEEEEcccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccEEHHHcccccccccccc //