[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57316.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  89/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.69.2b.70.2
:364 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   92->299 1l0qA PDBj 4e-28 36.5 %
:RPS:PDB   122->253 1c9iA PDBj 5e-08 10.9 %
:RPS:SCOP  36->301 1jmxB  b.69.2.2 * 8e-15 17.6 %
:HMM:SCOP  2->313 1nirA2 b.70.2.1 * 4.7e-40 32.3 %
:RPS:PFM   146->310 PF10282 * Muc_lac_enz 5e-09 32.7 %
:HMM:PFM   36->83 PF02239 * Cytochrom_D1 5.5e-05 25.0 48/369  
:HMM:PFM   196->275 PF10282 * Muc_lac_enz 1.4e-05 30.0 80/345  
:BLT:SWISS 89->301 HETE1_PODAN 2e-07 28.2 %
:REPEAT 3|143->182|184->226|228->270
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57316.1 GT:GENE BAD57316.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2630045..2631139) GB:FROM 2630045 GB:TO 2631139 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57316.1 LENGTH 364 SQ:AASEQ MAIRFRRRSGRAFALAAVVLSLLAPAAGADEGADIAYVPVMGEGAVLVVDTAADQVRARIDGVGAQAAAVAAARDGRQLYVQSANPPFTGPDDIAVVDRTSNTVTARIPISGTDGMTEPIADPVRDRVYVFTARPSIDVLDTVSNTLVRSMPLPAIPFAAAISPDGGKLYTVFADSTAAVFDPETGFQVGERIQIDGSLPASAAVSPDGRKLYTLNVLGDNVSVIDTQSWTRLGAIAFAPGSAPVAGAISPDGTQLMVATLGADAVQVIDLAADRVTRTVPVDAPLSVGFTADGAKMYVGSLGTHVAAPFTVPAAALDATTLLHTYLRTDPHAGALVPFHTATWQPAGAPIPTGSGPAAGAFLD GT:EXON 1|1-364:0| BL:SWS:NREP 1 BL:SWS:REP 89->301|HETE1_PODAN|2e-07|28.2|206/1356| NREPEAT 1 REPEAT 3|143->182|184->226|228->270| SEG 12->29|afalaavvlsllapaaga| SEG 61->78|dgvgaqaaavaaardgrq| SEG 311->327|tvpaaaldattllhtyl| BL:PDB:NREP 1 BL:PDB:REP 92->299|1l0qA|4e-28|36.5|200/385| RP:PDB:NREP 1 RP:PDB:REP 122->253|1c9iA|5e-08|10.9|129/355| RP:PFM:NREP 1 RP:PFM:REP 146->310|PF10282|5e-09|32.7|165/311|Muc_lac_enz| HM:PFM:NREP 2 HM:PFM:REP 36->83|PF02239|5.5e-05|25.0|48/369|Cytochrom_D1| HM:PFM:REP 196->275|PF10282|1.4e-05|30.0|80/345|Muc_lac_enz| RP:SCP:NREP 1 RP:SCP:REP 36->301|1jmxB|8e-15|17.6|261/339|b.69.2.2| HM:SCP:REP 2->313|1nirA2|4.7e-40|32.3|300/0|b.70.2.1|1/1|C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase| OP:NHOMO 166 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------1A9C--------------- 123-2------------11-11----11111-22221-12-1-1-------1----------1---11--------------------------------------------------------------------------------------------------1-11------------------------------1-1------------2---1-1----------1--------------------------------------------------------------------------------------------1------------1-----------------------------------------------4-11------------------1-44245245--------------11-3-----1-------------------1-----------------------------------------------------------111--1-----------2--11-11-1-----2111---------1--1-----------------1----3---------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------2-----------------------------------1--1-1111-1-1------------------------1-11111----------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 60.2 SQ:SECSTR #######################################################################################EcccccTTccccccEEEcccccTTcccccEEEEEEEEEEEEEcccccTTccccccEEEccccccccTTccEEEEEETTTTEEEEEETTcEEEEEETTTccEEEEEEcccccEEHEEEEETTTTEEEEEEEETTcEEEEEEcTTTHHHHHHTTTccHHHHHHHHHHHTTTccTcTTTccEEEEEccccTTcEEEEEEcHHHHcTTcTTTEEEEEEGGTEE########################################################## PSIPRED cccccEEcccccEEEHHHHHHHcccEEEEcccccEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEcccccccccEEEEEEccccEEEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEEcccEEEEEEcccccEEEEEEccccEEEEEEEEcccEEEEEEEEEEcccccccEEEEEEEEEEEcccccEEEEEEccccccccc //