[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57318.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->68 PF12085 * DUF3562 1.6e-06 25.6 43/66  
:BLT:SWISS 4->63 DPO4_SHEB9 2e-04 31.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57318.1 GT:GENE BAD57318.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2631920..2632132 GB:FROM 2631920 GB:TO 2632132 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57318.1 LENGTH 70 SQ:AASEQ MTAPSLDHDLALKMAADRLEREFGGAVPDAEIEQFLQDTYEHIADHATLDNFLPLLAERYTREWLRERTS GT:EXON 1|1-70:0| BL:SWS:NREP 1 BL:SWS:REP 4->63|DPO4_SHEB9|2e-04|31.7|60/358| HM:PFM:NREP 1 HM:PFM:REP 26->68|PF12085|1.6e-06|25.6|43/66|DUF3562| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------1----------11112-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 68-70| PSIPRED cccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc //